Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) /HTH_XRE(antitoxin)
Location 1973531..1974342 Replicon chromosome
Accession NZ_CP126540
Organism Staphylococcus cohnii strain SDAQ-1

Toxin (Protein)


Gene name - Uniprot ID -
Locus tag QMK35_RS09475 Protein ID WP_285159584.1
Coordinates 1973878..1974342 (+) Length 155 a.a.

Antitoxin (Protein)


Gene name - Uniprot ID -
Locus tag QMK35_RS09470 Protein ID WP_285159583.1
Coordinates 1973531..1973866 (+) Length 112 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QMK35_RS09420 (QMK35_09420) 1968722..1969222 - 501 WP_285159576.1 DUF669 domain-containing protein -
QMK35_RS09425 (QMK35_09425) 1969225..1969923 - 699 WP_285159577.1 hypothetical protein -
QMK35_RS09430 (QMK35_09430) 1969930..1971273 - 1344 WP_285159578.1 DEAD/DEAH box helicase family protein -
QMK35_RS09435 (QMK35_09435) 1971257..1971961 - 705 WP_285159579.1 AAA family ATPase -
QMK35_RS09440 (QMK35_09440) 1971951..1972175 - 225 WP_210139088.1 DUF2483 family protein -
QMK35_RS09445 (QMK35_09445) 1972172..1972435 - 264 WP_285159580.1 DUF1108 family protein -
QMK35_RS09450 (QMK35_09450) 1972502..1972678 - 177 WP_204174229.1 hypothetical protein -
QMK35_RS09455 (QMK35_09455) 1972680..1972886 - 207 WP_285159581.1 hypothetical protein -
QMK35_RS09460 (QMK35_09460) 1972899..1973108 - 210 WP_285159582.1 hypothetical protein -
QMK35_RS09465 (QMK35_09465) 1973136..1973366 - 231 WP_210129027.1 helix-turn-helix transcriptional regulator -
QMK35_RS09470 (QMK35_09470) 1973531..1973866 + 336 WP_285159583.1 helix-turn-helix transcriptional regulator Antitoxin
QMK35_RS09475 (QMK35_09475) 1973878..1974342 + 465 WP_285159584.1 ImmA/IrrE family metallo-endopeptidase Toxin
QMK35_RS09480 (QMK35_09480) 1974430..1975080 + 651 WP_285159585.1 DUF4352 domain-containing protein -
QMK35_RS09485 (QMK35_09485) 1975142..1976191 + 1050 WP_285159586.1 tyrosine-type recombinase/integrase -
QMK35_RS09500 (QMK35_09500) 1976563..1977126 - 564 WP_107384866.1 competence protein ComK -
QMK35_RS09505 (QMK35_09505) 1977378..1977596 + 219 WP_019469091.1 IDEAL domain-containing protein -
QMK35_RS09510 (QMK35_09510) 1977675..1978664 - 990 WP_019469090.1 lipoate--protein ligase -
QMK35_RS09515 (QMK35_09515) 1978862..1979047 + 186 WP_002508073.1 DUF2187 family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 1935761..1976191 40430


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

IrrE N-terminal-like domain

(31-122)

Antitoxin

Cro/C1-type helix-turn-helix domain

(8-65)


Sequences

Toxin        


Download         Length: 155 a.a.        Molecular weight: 18071.65 Da        Isoelectric Point: 5.2550

>T282962 WP_285159584.1 NZ_CP126540:1973878-1974342 [Staphylococcus cohnii]
MGSYEKLLAQYDDEIIIEETNLKKGLLGVYLGEVILIEKRLNSVNKLETLCEEIAHHLITYGDIRDQTKMLNRKFELKAR
RLGSELVISIDGLIDAFHHGVQNLYEMSQYFDVSEQYVLNALNNYKMKYGLDVYHNGYVIKFEPLQVFEHHNWD

Download         Length: 465 bp

Antitoxin


Download         Length: 112 a.a.        Molecular weight: 12926.59 Da        Isoelectric Point: 8.3906

>AT282962 WP_285159583.1 NZ_CP126540:1973531-1973866 [Staphylococcus cohnii]
MRNSEQIGKYIKQIRQQRQMSVTDLAKKVDVNKSTLSRYENGTRKIPMEDIANFANVLGVTPESILFEQKENNKNKSSFE
TIAAHLDGDLTEEEWQEILDYAEYVKSKRKK

Download         Length: 336 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References