Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
Location | 950653..951182 | Replicon | chromosome |
Accession | NZ_CP126540 | ||
Organism | Staphylococcus cohnii strain SDAQ-1 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | A0A6N7XWP7 |
Locus tag | QMK35_RS04395 | Protein ID | WP_019468010.1 |
Coordinates | 950820..951182 (+) | Length | 121 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | A0A6N7Y6B0 |
Locus tag | QMK35_RS04390 | Protein ID | WP_019468009.1 |
Coordinates | 950653..950823 (+) | Length | 57 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QMK35_RS04365 (QMK35_04365) | 946464..946943 | + | 480 | WP_107384543.1 | PH domain-containing protein | - |
QMK35_RS04370 (QMK35_04370) | 946936..948441 | + | 1506 | WP_107384542.1 | PH domain-containing protein | - |
QMK35_RS04375 (QMK35_04375) | 948434..948925 | + | 492 | WP_107384541.1 | PH domain-containing protein | - |
QMK35_RS04380 (QMK35_04380) | 948961..949311 | + | 351 | WP_107384540.1 | holo-ACP synthase | - |
QMK35_RS04385 (QMK35_04385) | 949417..950565 | + | 1149 | WP_107386317.1 | alanine racemase | - |
QMK35_RS04390 (QMK35_04390) | 950653..950823 | + | 171 | WP_019468009.1 | type II toxin-antitoxin system antitoxin MazE | Antitoxin |
QMK35_RS04395 (QMK35_04395) | 950820..951182 | + | 363 | WP_019468010.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
QMK35_RS04400 (QMK35_04400) | 951526..952527 | + | 1002 | WP_107384538.1 | PP2C family protein-serine/threonine phosphatase | - |
QMK35_RS04405 (QMK35_04405) | 952596..952922 | + | 327 | WP_019468012.1 | anti-sigma factor antagonist | - |
QMK35_RS04410 (QMK35_04410) | 952924..953406 | + | 483 | WP_019468013.1 | anti-sigma B factor RsbW | - |
QMK35_RS04415 (QMK35_04415) | 953381..954151 | + | 771 | WP_107384537.1 | RNA polymerase sigma factor SigB | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 121 a.a. Molecular weight: 13595.69 Da Isoelectric Point: 9.9426
>T282961 WP_019468010.1 NZ_CP126540:950820-951182 [Staphylococcus cohnii]
MMRRGDVYLADLSPVQGSEQGGIRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKSKYKLDKDSVILLEQIR
TLDKNRLKEKLTYLSEEKMQEVNNAIDISLGLHNIRNHRT
MMRRGDVYLADLSPVQGSEQGGIRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKSKYKLDKDSVILLEQIR
TLDKNRLKEKLTYLSEEKMQEVNNAIDISLGLHNIRNHRT
Download Length: 363 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A6N7XWP7 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A6N7Y6B0 |