Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/VapC-VagC
Location 2684054..2684685 Replicon chromosome
Accession NZ_CP126539
Organism Devosia sp. RR2S18

Toxin (Protein)


Gene name vapC Uniprot ID -
Locus tag QOV41_RS13175 Protein ID WP_284577175.1
Coordinates 2684054..2684452 (-) Length 133 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID -
Locus tag QOV41_RS13180 Protein ID WP_284577177.1
Coordinates 2684452..2684685 (-) Length 78 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QOV41_RS13140 (QOV41_13140) 2679193..2679690 + 498 WP_284577166.1 BA14K family protein -
QOV41_RS13145 (QOV41_13145) 2679979..2680125 - 147 WP_284577168.1 hypothetical protein -
QOV41_RS13150 (QOV41_13150) 2680685..2681212 - 528 WP_284577169.1 RES domain-containing protein -
QOV41_RS13155 (QOV41_13155) 2681205..2681576 - 372 WP_284577171.1 DUF2384 domain-containing protein -
QOV41_RS13160 (QOV41_13160) 2681827..2682210 - 384 WP_284577173.1 type II toxin-antitoxin system PemK/MazF family toxin -
QOV41_RS13165 (QOV41_13165) 2682687..2682938 - 252 Protein_2592 transposase domain-containing protein -
QOV41_RS13170 (QOV41_13170) 2683628..2683828 + 201 WP_284581326.1 hypothetical protein -
QOV41_RS13175 (QOV41_13175) 2684054..2684452 - 399 WP_284577175.1 type II toxin-antitoxin system VapC family toxin Toxin
QOV41_RS13180 (QOV41_13180) 2684452..2684685 - 234 WP_284577177.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
QOV41_RS13185 (QOV41_13185) 2684935..2685095 - 161 Protein_2596 ATP-binding protein -
QOV41_RS13190 (QOV41_13190) 2685369..2685542 + 174 Protein_2597 transposase -
QOV41_RS13195 (QOV41_13195) 2686320..2687081 - 762 WP_284577179.1 hypothetical protein -
QOV41_RS13200 (QOV41_13200) 2687849..2688191 - 343 Protein_2599 transposase -
QOV41_RS13205 (QOV41_13205) 2689348..2689587 - 240 WP_284577180.1 tyrosine-type recombinase/integrase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(4-124)

Antitoxin

SpoVT-AbrB domain

(7-55)


Sequences

Toxin        


Download         Length: 133 a.a.        Molecular weight: 14928.21 Da        Isoelectric Point: 7.3515

>T282959 WP_284577175.1 NZ_CP126539:c2684452-2684054 [Devosia sp. RR2S18]
MLTYMLDTNICIYVMKTYPPALREKFNALAEQLCISSITLGELHYGAEKSMRRAENLVAIDHFAGRLEVLSFAEKAASHY
GQIRAELERAGTPCRPHDMQIGGHARSEGLILVTNNMREFSRMPGLRSENWV

Download         Length: 399 bp

Antitoxin


Download         Length: 78 a.a.        Molecular weight: 8720.94 Da        Isoelectric Point: 8.9366

>AT282959 WP_284577177.1 NZ_CP126539:c2684685-2684452 [Devosia sp. RR2S18]
MTKSTIFMSNRSQAVRLPKAVAFPGHVHQVDVLKVGRSRLIVPQGQRWDDLFELGPRVSGDFLSEREQPAAEEREAF

Download         Length: 234 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References