Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 160783..161426 Replicon plasmid pblaNDM5-S1
Accession NZ_CP126537
Organism Citrobacter freundii strain CRNMS1

Toxin (Protein)


Gene name vagD Uniprot ID A0A6C0NE46
Locus tag QOK75_RS27455 Protein ID WP_008322233.1
Coordinates 161010..161426 (+) Length 139 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID Q84A07
Locus tag QOK75_RS27450 Protein ID WP_001261276.1
Coordinates 160783..161013 (+) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QOK75_RS27420 (QOK75_27420) 156098..156337 - 240 WP_001549892.1 hypothetical protein -
QOK75_RS27425 (QOK75_27425) 156439..157659 + 1221 WP_000343760.1 ISL3-like element ISKox3 family transposase -
QOK75_RS27430 (QOK75_27430) 157748..158281 - 534 Protein_204 recombinase family protein -
QOK75_RS27435 (QOK75_27435) 158376..158774 - 399 WP_003089120.1 Hg(II)-responsive transcriptional regulator -
QOK75_RS27440 (QOK75_27440) 158871..159575 - 705 WP_001067855.1 IS6-like element IS26 family transposase -
QOK75_RS27445 (QOK75_27445) 159682..160530 + 849 WP_200007353.1 DNA helicase UvrD -
QOK75_RS27450 (QOK75_27450) 160783..161013 + 231 WP_001261276.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
QOK75_RS27455 (QOK75_27455) 161010..161426 + 417 WP_008322233.1 type II toxin-antitoxin system VapC family toxin Toxin
QOK75_RS27460 (QOK75_27460) 161972..162892 - 921 WP_008322235.1 carbohydrate kinase -
QOK75_RS27465 (QOK75_27465) 162889..164259 - 1371 WP_008322237.1 hypothetical protein -
QOK75_RS27470 (QOK75_27470) 164337..165356 - 1020 WP_004113181.1 ribose ABC transporter permease -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid sul2 / floR / aadA5 / qacE / sul1 / qnrA1 / blaNDM-5 - 1..197210 197210


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(6-129)

Antitoxin

SpoVT-AbrB domain

(7-47)


Sequences

Toxin        


Download         Length: 139 a.a.        Molecular weight: 15054.58 Da        Isoelectric Point: 9.2957

>T282957 WP_008322233.1 NZ_CP126537:161010-161426 [Citrobacter freundii]
MKKTWMLDTNICSFIMREQPAAVLKRLEQAVLRGDRIVVSAVTYAEMRFGATGPKASPRHIQLVDAFCARLDAVLPWDRA
AVDATTDIRVALRLAGTPIGPNDTAIAGHAIAASAVLVTNNVREFARVPGLMLEDWVK

Download         Length: 417 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8721.74 Da        Isoelectric Point: 4.3533

>AT282957 WP_001261276.1 NZ_CP126537:160783-161013 [Citrobacter freundii]
MRTVSIFKNGNNRAIRLPRDLDFDGVSELEIVREGDSIILRPVRPTWGSFAQLDRADPDFMAEREDVVSDEGRFEP

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A6C0NE46

Antitoxin

Source ID Structure
AlphaFold DB A0A387K023

References