Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/LOTUS_5_Limkain_b1(toxin) |
| Location | 5145620..5146236 | Replicon | chromosome |
| Accession | NZ_CP126536 | ||
| Organism | Citrobacter freundii strain CRNMS1 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | A0A0J1MQ96 |
| Locus tag | QOK75_RS25565 | Protein ID | WP_003028682.1 |
| Coordinates | 5145620..5145994 (-) | Length | 125 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | A0A6B5NTK4 |
| Locus tag | QOK75_RS25570 | Protein ID | WP_043018956.1 |
| Coordinates | 5145994..5146236 (-) | Length | 81 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QOK75_RS25550 (5143123) | 5143123..5144025 | + | 903 | WP_003028691.1 | formate dehydrogenase O subunit beta | - |
| QOK75_RS25555 (5144022) | 5144022..5144657 | + | 636 | WP_003028686.1 | formate dehydrogenase cytochrome b556 subunit | - |
| QOK75_RS25560 (5144654) | 5144654..5145583 | + | 930 | WP_003028685.1 | formate dehydrogenase accessory protein FdhE | - |
| QOK75_RS25565 (5145620) | 5145620..5145994 | - | 375 | WP_003028682.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| QOK75_RS25570 (5145994) | 5145994..5146236 | - | 243 | WP_043018956.1 | CopG family transcriptional regulator | Antitoxin |
| QOK75_RS25575 (5146442) | 5146442..5147350 | + | 909 | WP_003847901.1 | alpha/beta hydrolase | - |
| QOK75_RS25580 (5147501) | 5147501..5148442 | - | 942 | WP_003825286.1 | fatty acid biosynthesis protein FabY | - |
| QOK75_RS25585 (5148487) | 5148487..5148924 | - | 438 | WP_003028671.1 | D-aminoacyl-tRNA deacylase | - |
| QOK75_RS25590 (5148921) | 5148921..5149793 | - | 873 | WP_003028669.1 | virulence factor BrkB family protein | - |
| QOK75_RS25595 (5149787) | 5149787..5150386 | - | 600 | WP_003028663.1 | glucose-1-phosphatase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 125 a.a. Molecular weight: 13674.89 Da Isoelectric Point: 9.5622
>T282954 WP_003028682.1 NZ_CP126536:c5145994-5145620 [Citrobacter freundii]
MVKGSALFDTNILIDLFSGRNEAKLAIETWPPQNAISLITWMEVMVGAKKYHQEARTRVALGAFNVIGVSQDIAERSVSI
RQEYGMKLPDAIILATAQIHRLTLVTRNTKDFAGLSGVVTPYTL
MVKGSALFDTNILIDLFSGRNEAKLAIETWPPQNAISLITWMEVMVGAKKYHQEARTRVALGAFNVIGVSQDIAERSVSI
RQEYGMKLPDAIILATAQIHRLTLVTRNTKDFAGLSGVVTPYTL
Download Length: 375 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0J1MQ96 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A6B5NTK4 |