Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tad-ata/COG5606-COG4679 |
Location | 4958901..4959567 | Replicon | chromosome |
Accession | NZ_CP126536 | ||
Organism | Citrobacter freundii strain CRNMS1 |
Toxin (Protein)
Gene name | tad | Uniprot ID | - |
Locus tag | QOK75_RS24635 | Protein ID | WP_134214823.1 |
Coordinates | 4959208..4959567 (-) | Length | 120 a.a. |
Antitoxin (Protein)
Gene name | ata | Uniprot ID | - |
Locus tag | QOK75_RS24630 | Protein ID | WP_134214821.1 |
Coordinates | 4958901..4959218 (-) | Length | 106 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QOK75_RS24590 (4954312) | 4954312..4954629 | - | 318 | WP_054527950.1 | CcdB family protein | - |
QOK75_RS24595 (4954629) | 4954629..4954922 | - | 294 | WP_003844689.1 | type II toxin-antitoxin system CcdA family antitoxin | - |
QOK75_RS24600 (4955019) | 4955019..4955384 | - | 366 | WP_134214819.1 | hypothetical protein | - |
QOK75_RS24605 (4955516) | 4955516..4955689 | + | 174 | WP_032938222.1 | hypothetical protein | - |
QOK75_RS24610 (4955823) | 4955823..4956077 | + | 255 | Protein_4827 | transposase | - |
QOK75_RS24615 (4956308) | 4956308..4957648 | + | 1341 | WP_008786676.1 | IS110 family transposase | - |
QOK75_RS24620 (4957662) | 4957662..4958579 | + | 918 | Protein_4829 | IS3 family transposase | - |
QOK75_RS24625 (4958600) | 4958600..4958761 | + | 162 | WP_003841416.1 | phage protein | - |
QOK75_RS24630 (4958901) | 4958901..4959218 | - | 318 | WP_134214821.1 | helix-turn-helix transcriptional regulator | Antitoxin |
QOK75_RS24635 (4959208) | 4959208..4959567 | - | 360 | WP_134214823.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
QOK75_RS24640 (4959781) | 4959781..4960470 | + | 690 | WP_003841421.1 | dipeptidase PepE | - |
QOK75_RS24645 (4960617) | 4960617..4962248 | - | 1632 | WP_134214825.1 | Na/Pi cotransporter family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 120 a.a. Molecular weight: 13456.53 Da Isoelectric Point: 10.2555
>T282953 WP_134214823.1 NZ_CP126536:c4959567-4959208 [Citrobacter freundii]
MTKPLYWVGQARKDLLAMPEHVRDTFGFAFWLAQQGKQHSQTKPLKGFGGAGVLEVVEDYHGSAWRAVYTIQLKNAVYVL
HVFQKKSVSGKATPKPEIDLIYQRLKAAQRHAQESGYVI
MTKPLYWVGQARKDLLAMPEHVRDTFGFAFWLAQQGKQHSQTKPLKGFGGAGVLEVVEDYHGSAWRAVYTIQLKNAVYVL
HVFQKKSVSGKATPKPEIDLIYQRLKAAQRHAQESGYVI
Download Length: 360 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|