Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeV-yafW/CbtA-CbeA
Location 4762420..4763213 Replicon chromosome
Accession NZ_CP126536
Organism Citrobacter freundii strain CRNMS1

Toxin (Protein)


Gene name yeeV Uniprot ID S1EZ92
Locus tag QOK75_RS23610 Protein ID WP_000854726.1
Coordinates 4762836..4763213 (+) Length 126 a.a.

Antitoxin (Protein)


Gene name yafW Uniprot ID S1EBQ7
Locus tag QOK75_RS23605 Protein ID WP_001548930.1
Coordinates 4762420..4762746 (+) Length 109 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QOK75_RS23555 (4757724) 4757724..4758545 + 822 WP_008324532.1 DUF932 domain-containing protein -
QOK75_RS23560 (4758763) 4758763..4759464 + 702 WP_008324530.1 WYL domain-containing protein -
QOK75_RS23565 (4759511) 4759511..4759747 + 237 WP_001115854.1 protein YpjK -
QOK75_RS23570 (4759747) 4759747..4760190 + 444 WP_053263801.1 lipoprotein YafY -
QOK75_RS23575 (4760213) 4760213..4760680 + 468 WP_001547765.1 protein YkfB -
QOK75_RS23580 (4760757) 4760757..4761011 + 255 WP_101743273.1 DUF905 domain-containing protein -
QOK75_RS23585 (4761001) 4761001..4761123 + 123 WP_077760868.1 DUF905 family protein -
QOK75_RS23590 (4761221) 4761221..4761679 + 459 WP_000211838.1 antirestriction protein -
QOK75_RS23595 (4761695) 4761695..4762171 + 477 WP_016243826.1 RadC family protein -
QOK75_RS23600 (4762180) 4762180..4762401 + 222 WP_016239820.1 DUF987 domain-containing protein -
QOK75_RS23605 (4762420) 4762420..4762746 + 327 WP_001548930.1 type IV toxin-antitoxin system antitoxin YafW Antitoxin
QOK75_RS23610 (4762836) 4762836..4763213 + 378 WP_000854726.1 TA system toxin CbtA family protein Toxin
QOK75_RS23615 (4763210) 4763210..4763698 + 489 WP_001547769.1 DUF5983 family protein -
QOK75_RS23620 (4763710) 4763710..4763907 + 198 WP_000839269.1 DUF957 domain-containing protein -
QOK75_RS23625 (4763992) 4763992..4764834 + 843 WP_001548928.1 DUF4942 domain-containing protein -
QOK75_RS23630 (4765406) 4765406..4767067 + 1662 WP_046670801.1 fatty acid--CoA ligase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Integrative and Conjugative Element blaTEM-1B / mph(A) / sul1 / qacE / aadA2 / dfrA12 - 4620614..4764961 144347


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(6-103)


Sequences

Toxin        


Download         Length: 126 a.a.        Molecular weight: 14164.10 Da        Isoelectric Point: 7.8045

>T282951 WP_000854726.1 NZ_CP126536:4762836-4763213 [Citrobacter freundii]
MKTLPDTHVREASRCPSPVTIWQTLLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITQGKHPEAKQ

Download         Length: 378 bp

Antitoxin


Download         Length: 109 a.a.        Molecular weight: 12301.97 Da        Isoelectric Point: 7.0273

>AT282951 WP_001548930.1 NZ_CP126536:4762420-4762746 [Citrobacter freundii]
MSNPTRGLQREITLRLGARLVQEGNRLHYLADRASITGKFSDIECRKLDETFPHFIRQMESMLTTGELSPHHAHCVTLYH
NDLTCEADTFGSCGYVYLAVYPTPETKK

Download         Length: 327 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB S1EZ92

Antitoxin

Source ID Structure
AlphaFold DB S1EBQ7

References