Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | relBE/ParE-RelB |
Location | 4501432..4501948 | Replicon | chromosome |
Accession | NZ_CP126536 | ||
Organism | Citrobacter freundii strain CRNMS1 |
Toxin (Protein)
Gene name | relE | Uniprot ID | A0A0D7LMW6 |
Locus tag | QOK75_RS22170 | Protein ID | WP_003839578.1 |
Coordinates | 4501432..4501716 (-) | Length | 95 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | - |
Locus tag | QOK75_RS22175 | Protein ID | WP_134216310.1 |
Coordinates | 4501706..4501948 (-) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QOK75_RS22155 (4497757) | 4497757..4498341 | + | 585 | WP_003839584.1 | fructose PTS transporter subunit IIA | - |
QOK75_RS22160 (4498719) | 4498719..4500857 | + | 2139 | WP_003025782.1 | anaerobic ribonucleoside-triphosphate reductase | - |
QOK75_RS22165 (4500964) | 4500964..4501428 | + | 465 | WP_032937736.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
QOK75_RS22170 (4501432) | 4501432..4501716 | - | 285 | WP_003839578.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
QOK75_RS22175 (4501706) | 4501706..4501948 | - | 243 | WP_134216310.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
QOK75_RS22180 (4502026) | 4502026..4503939 | - | 1914 | WP_134216312.1 | BglG family transcription antiterminator | - |
QOK75_RS22185 (4503961) | 4503961..4504701 | - | 741 | WP_048216922.1 | KDGP aldolase family protein | - |
QOK75_RS22190 (4504698) | 4504698..4505816 | - | 1119 | WP_003025770.1 | DgaE family pyridoxal phosphate-dependent ammonia lyase | - |
QOK75_RS22195 (4505800) | 4505800..4506933 | - | 1134 | WP_016149471.1 | amidohydrolase/deacetylase family metallohydrolase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 10866.68 Da Isoelectric Point: 10.0482
>T282950 WP_003839578.1 NZ_CP126536:c4501716-4501432 [Citrobacter freundii]
MTYELEFDPRALKEWHKLGDTVKAQFKKKLADVLLNPRIDSARLNGLPDCYKIKLKSSGYRLVYQVRDEVVTVFVVAVGK
REHSAVYLDANKRL
MTYELEFDPRALKEWHKLGDTVKAQFKKKLADVLLNPRIDSARLNGLPDCYKIKLKSSGYRLVYQVRDEVVTVFVVAVGK
REHSAVYLDANKRL
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|