Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | ykfI-yeeU/CbtA-CbeA |
Location | 4432410..4433131 | Replicon | chromosome |
Accession | NZ_CP126536 | ||
Organism | Citrobacter freundii strain CRNMS1 |
Toxin (Protein)
Gene name | ykfI | Uniprot ID | - |
Locus tag | QOK75_RS21845 | Protein ID | WP_063149808.1 |
Coordinates | 4432410..4432751 (-) | Length | 114 a.a. |
Antitoxin (Protein)
Gene name | yeeU | Uniprot ID | - |
Locus tag | QOK75_RS21850 | Protein ID | WP_080460847.1 |
Coordinates | 4432787..4433131 (-) | Length | 115 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QOK75_RS21815 (4428426) | 4428426..4428788 | + | 363 | WP_003837149.1 | endoribonuclease SymE | - |
QOK75_RS21820 (4428947) | 4428947..4429819 | + | 873 | WP_134216258.1 | HNH endonuclease | - |
QOK75_RS21825 (4429948) | 4429948..4430742 | - | 795 | WP_134216261.1 | helix-turn-helix transcriptional regulator | - |
QOK75_RS21830 (4430858) | 4430858..4431133 | - | 276 | WP_063149810.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
QOK75_RS21835 (4431137) | 4431137..4431385 | - | 249 | WP_000535213.1 | ribbon-helix-helix domain-containing protein | - |
QOK75_RS21840 (4431462) | 4431462..4432295 | - | 834 | WP_063149809.1 | DUF4942 domain-containing protein | - |
QOK75_RS21845 (4432410) | 4432410..4432751 | - | 342 | WP_063149808.1 | TA system toxin CbtA family protein | Toxin |
QOK75_RS21850 (4432787) | 4432787..4433131 | - | 345 | WP_080460847.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
QOK75_RS21855 (4433155) | 4433155..4433376 | - | 222 | WP_063149807.1 | DUF987 family protein | - |
QOK75_RS21860 (4433324) | 4433324..4433860 | - | 537 | WP_080460846.1 | DNA repair protein RadC | - |
QOK75_RS21865 (4433930) | 4433930..4434748 | - | 819 | WP_172616074.1 | DUF932 domain-containing protein | - |
QOK75_RS21870 (4434888) | 4434888..4435139 | - | 252 | WP_063149806.1 | DUF905 family protein | - |
QOK75_RS21875 (4435136) | 4435136..4435807 | - | 672 | WP_063149805.1 | hypothetical protein | - |
QOK75_RS21880 (4435990) | 4435990..4436379 | - | 390 | WP_063149804.1 | hypothetical protein | - |
QOK75_RS21885 (4436376) | 4436376..4437098 | - | 723 | WP_232051960.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 12865.79 Da Isoelectric Point: 9.8519
>T282949 WP_063149808.1 NZ_CP126536:c4432751-4432410 [Citrobacter freundii]
MKAFPATNQRVAKPCPSPVAVWQMLLTRLLAQHYGLTLNDTPFNDESVIQEHINAGITLADAVNFLVEKNELVRIDRRGF
SWQEQSPYLRAVDILRARQATGLLRQSHNLLTR
MKAFPATNQRVAKPCPSPVAVWQMLLTRLLAQHYGLTLNDTPFNDESVIQEHINAGITLADAVNFLVEKNELVRIDRRGF
SWQEQSPYLRAVDILRARQATGLLRQSHNLLTR
Download Length: 342 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|