Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 3818348..3818968 | Replicon | chromosome |
| Accession | NZ_CP126536 | ||
| Organism | Citrobacter freundii strain CRNMS1 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | R8WYV2 |
| Locus tag | QOK75_RS18985 | Protein ID | WP_002892050.1 |
| Coordinates | 3818750..3818968 (+) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | R8WZW8 |
| Locus tag | QOK75_RS18980 | Protein ID | WP_003021733.1 |
| Coordinates | 3818348..3818722 (+) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QOK75_RS18970 (3813494) | 3813494..3814687 | + | 1194 | WP_003835922.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
| QOK75_RS18975 (3814710) | 3814710..3817859 | + | 3150 | WP_003021736.1 | efflux RND transporter permease AcrB | - |
| QOK75_RS18980 (3818348) | 3818348..3818722 | + | 375 | WP_003021733.1 | Hha toxicity modulator TomB | Antitoxin |
| QOK75_RS18985 (3818750) | 3818750..3818968 | + | 219 | WP_002892050.1 | HHA domain-containing protein | Toxin |
| QOK75_RS18990 (3819275) | 3819275..3819826 | + | 552 | WP_134216077.1 | maltose O-acetyltransferase | - |
| QOK75_RS18995 (3819943) | 3819943..3820413 | + | 471 | WP_003021724.1 | YlaC family protein | - |
| QOK75_RS19000 (3820492) | 3820492..3820632 | - | 141 | WP_005125190.1 | type B 50S ribosomal protein L36 | - |
| QOK75_RS19005 (3820634) | 3820634..3820894 | - | 261 | WP_003835926.1 | type B 50S ribosomal protein L31 | - |
| QOK75_RS19010 (3821083) | 3821083..3822636 | + | 1554 | WP_142710219.1 | EAL domain-containing protein | - |
| QOK75_RS19015 (3822688) | 3822688..3823041 | - | 354 | WP_003831033.1 | DUF1428 family protein | - |
| QOK75_RS19020 (3823106) | 3823106..3823735 | - | 630 | WP_016149709.1 | membrane protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T282947 WP_002892050.1 NZ_CP126536:3818750-3818968 [Citrobacter freundii]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14427.23 Da Isoelectric Point: 5.5653
>AT282947 WP_003021733.1 NZ_CP126536:3818348-3818722 [Citrobacter freundii]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEQSNHGWVNDPTSATSLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEQSNHGWVNDPTSATSLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2P8K6F2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | R8WZW8 |