Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | pemIK/PRK09812-MazE |
Location | 3088114..3088704 | Replicon | chromosome |
Accession | NZ_CP126536 | ||
Organism | Citrobacter freundii strain CRNMS1 |
Toxin (Protein)
Gene name | pemK | Uniprot ID | A0A0J1NBD3 |
Locus tag | QOK75_RS15365 | Protein ID | WP_003836692.1 |
Coordinates | 3088114..3088446 (-) | Length | 111 a.a. |
Antitoxin (Protein)
Gene name | pemI | Uniprot ID | A0A0J1NBD4 |
Locus tag | QOK75_RS15370 | Protein ID | WP_003836694.1 |
Coordinates | 3088447..3088704 (-) | Length | 86 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QOK75_RS15340 (3083867) | 3083867..3085354 | + | 1488 | WP_003846749.1 | EmmdR/YeeO family multidrug/toxin efflux MATE transporter | - |
QOK75_RS15350 (3085670) | 3085670..3086620 | - | 951 | WP_134215814.1 | HTH-type transcriptional regulator Cbl | - |
QOK75_RS15355 (3086722) | 3086722..3087639 | - | 918 | WP_003030855.1 | nitrogen assimilation transcriptional regulator NAC | - |
QOK75_RS15365 (3088114) | 3088114..3088446 | - | 333 | WP_003836692.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
QOK75_RS15370 (3088447) | 3088447..3088704 | - | 258 | WP_003836694.1 | hypothetical protein | Antitoxin |
QOK75_RS15375 (3089318) | 3089318..3093217 | + | 3900 | WP_240210323.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 111 a.a. Molecular weight: 11703.48 Da Isoelectric Point: 8.5572
>T282946 WP_003836692.1 NZ_CP126536:c3088446-3088114 [Citrobacter freundii]
MDRGEIWLVSLDPTAGHEQSGKRPVLIVSPASFNKFTRLPVVVPVTSGGNFARAAGFTVSLDGAGTKTTGVIRCDQPRTI
DMGARNGKCLERIPEAVVNEVLARLEAILS
MDRGEIWLVSLDPTAGHEQSGKRPVLIVSPASFNKFTRLPVVVPVTSGGNFARAAGFTVSLDGAGTKTTGVIRCDQPRTI
DMGARNGKCLERIPEAVVNEVLARLEAILS
Download Length: 333 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0J1NBD3 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0J1NBD4 |