Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/UPF0150(antitoxin) |
Location | 2873740..2874379 | Replicon | chromosome |
Accession | NZ_CP126536 | ||
Organism | Citrobacter freundii strain CRNMS1 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | A0A8B5QF36 |
Locus tag | QOK75_RS14260 | Protein ID | WP_003020221.1 |
Coordinates | 2874203..2874379 (-) | Length | 59 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | - |
Locus tag | QOK75_RS14255 | Protein ID | WP_123924900.1 |
Coordinates | 2873740..2874156 (-) | Length | 139 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QOK75_RS14235 (2868786) | 2868786..2869730 | - | 945 | WP_003843727.1 | ABC transporter permease | - |
QOK75_RS14240 (2869731) | 2869731..2870747 | - | 1017 | WP_058842662.1 | ABC transporter ATP-binding protein | - |
QOK75_RS14245 (2870764) | 2870764..2871909 | - | 1146 | WP_134215522.1 | ABC transporter substrate-binding protein | - |
QOK75_RS14250 (2872238) | 2872238..2873647 | - | 1410 | WP_134215520.1 | PLP-dependent aminotransferase family protein | - |
QOK75_RS14255 (2873740) | 2873740..2874156 | - | 417 | WP_123924900.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
QOK75_RS14260 (2874203) | 2874203..2874379 | - | 177 | WP_003020221.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
QOK75_RS14265 (2874643) | 2874643..2876046 | + | 1404 | WP_003020224.1 | cytochrome ubiquinol oxidase subunit I | - |
QOK75_RS14270 (2876046) | 2876046..2877056 | + | 1011 | WP_003020227.1 | cytochrome d ubiquinol oxidase subunit II | - |
QOK75_RS14275 (2877056) | 2877056..2877181 | + | 126 | WP_003020230.1 | DUF2474 domain-containing protein | - |
QOK75_RS14280 (2877371) | 2877371..2877601 | + | 231 | WP_003020233.1 | DUF2554 family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6769.80 Da Isoelectric Point: 11.2510
>T282945 WP_003020221.1 NZ_CP126536:c2874379-2874203 [Citrobacter freundii]
VKQSEFRRWLESQGVAVTNGSNHLKLRYQGRRSVMPRHPGDEIKEALRKAIIKQLDLQ
VKQSEFRRWLESQGVAVTNGSNHLKLRYQGRRSVMPRHPGDEIKEALRKAIIKQLDLQ
Download Length: 177 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15126.36 Da Isoelectric Point: 4.5716
>AT282945 WP_123924900.1 NZ_CP126536:c2874156-2873740 [Citrobacter freundii]
MRYPVTLTPAVEGGFVVSFPDIPEALTQGNTRHDALQAAQAALITAFEFYFDDNEAIPLPSAVSAEDDYVEIPLSVASKV
LLLNAFLESKITQQELANRIGRPKQEITRLFDLKHTTKIDAVQIAARALGKELALTML
MRYPVTLTPAVEGGFVVSFPDIPEALTQGNTRHDALQAAQAALITAFEFYFDDNEAIPLPSAVSAEDDYVEIPLSVASKV
LLLNAFLESKITQQELANRIGRPKQEITRLFDLKHTTKIDAVQIAARALGKELALTML
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|