Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 944977..945631 | Replicon | chromosome |
Accession | NZ_CP126536 | ||
Organism | Citrobacter freundii strain CRNMS1 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | A0A0J1NHY7 |
Locus tag | QOK75_RS04720 | Protein ID | WP_003026936.1 |
Coordinates | 945224..945631 (+) | Length | 136 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | A0A6H3AT26 |
Locus tag | QOK75_RS04715 | Protein ID | WP_003026938.1 |
Coordinates | 944977..945243 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QOK75_RS04690 (940178) | 940178..941611 | - | 1434 | WP_003838263.1 | 6-phospho-beta-glucosidase BglA | - |
QOK75_RS04695 (941732) | 941732..942460 | - | 729 | WP_003838265.1 | MurR/RpiR family transcriptional regulator | - |
QOK75_RS04700 (942513) | 942513..942824 | + | 312 | WP_003026949.1 | N(4)-acetylcytidine aminohydrolase | - |
QOK75_RS04705 (942987) | 942987..943646 | + | 660 | WP_003838267.1 | hemolysin III family protein | - |
QOK75_RS04710 (943740) | 943740..944720 | - | 981 | WP_003838269.1 | tRNA-modifying protein YgfZ | - |
QOK75_RS04715 (944977) | 944977..945243 | + | 267 | WP_003026938.1 | FAD assembly factor SdhE | Antitoxin |
QOK75_RS04720 (945224) | 945224..945631 | + | 408 | WP_003026936.1 | protein YgfX | Toxin |
QOK75_RS04725 (945676) | 945676..946197 | - | 522 | WP_003026933.1 | flavodoxin FldB | - |
QOK75_RS04730 (946311) | 946311..947207 | + | 897 | WP_003026928.1 | site-specific tyrosine recombinase XerD | - |
QOK75_RS04735 (947231) | 947231..947944 | + | 714 | WP_003825520.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
QOK75_RS04740 (947950) | 947950..949683 | + | 1734 | WP_016150943.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 15953.89 Da Isoelectric Point: 11.4054
>T282940 WP_003026936.1 NZ_CP126536:945224-945631 [Citrobacter freundii]
VVQWQSDLRVSWRAQWLSLLIHGLVAVFILLMPWPLSYTPLWLVLLSLVVFDSVRSQRRINACQGEIRLLMDGRLRWQGQ
EWSIVSAPWMVKTGMMLRLRSDAGKRQHLWLAADSMDDAEWRDLRRLMLQKAKQK
VVQWQSDLRVSWRAQWLSLLIHGLVAVFILLMPWPLSYTPLWLVLLSLVVFDSVRSQRRINACQGEIRLLMDGRLRWQGQ
EWSIVSAPWMVKTGMMLRLRSDAGKRQHLWLAADSMDDAEWRDLRRLMLQKAKQK
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0J1NHY7 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A6H3AT26 |