Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-RelB
Location 377946..378532 Replicon chromosome
Accession NZ_CP126536
Organism Citrobacter freundii strain CRNMS1

Toxin (Protein)


Gene name doc Uniprot ID A0A0J1QS94
Locus tag QOK75_RS01840 Protein ID WP_032937237.1
Coordinates 378164..378532 (+) Length 123 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID A0A0J1N092
Locus tag QOK75_RS01835 Protein ID WP_032937236.1
Coordinates 377946..378167 (+) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QOK75_RS01810 (373745) 373745..374671 + 927 WP_003023435.1 high-affinity branched-chain amino acid ABC transporter permease LivH -
QOK75_RS01815 (374668) 374668..375945 + 1278 WP_003023436.1 branched chain amino acid ABC transporter permease LivM -
QOK75_RS01820 (375942) 375942..376709 + 768 WP_003023438.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG -
QOK75_RS01825 (376727) 376727..377440 + 714 WP_003827581.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF -
QOK75_RS01830 (377543) 377543..377824 + 282 WP_003023442.1 hypothetical protein -
QOK75_RS01835 (377946) 377946..378167 + 222 WP_032937236.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
QOK75_RS01840 (378164) 378164..378532 + 369 WP_032937237.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
QOK75_RS01845 (378776) 378776..380092 + 1317 WP_003837839.1 sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB -
QOK75_RS01850 (380193) 380193..381080 + 888 WP_003837841.1 sn-glycerol-3-phosphate ABC transporter permease UgpA -
QOK75_RS01855 (381077) 381077..381922 + 846 WP_003023450.1 sn-glycerol-3-phosphate ABC transporter permease UgpE -
QOK75_RS01860 (381925) 381925..382995 + 1071 WP_003837845.1 sn-glycerol-3-phosphate import ATP-binding protein UgpC -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 374668..383735 9067


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Death on curing protein

(1-121)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-50)


Sequences

Toxin        


Download         Length: 123 a.a.        Molecular weight: 13617.91 Da        Isoelectric Point: 6.9891

>T282938 WP_032937237.1 NZ_CP126536:378164-378532 [Citrobacter freundii]
MTLQIISAEEIIQFHDRLLRVTPGVAGMPDPGRAEALMYRVLNQIEYEGVTDVWLLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGIVLSANPDFVAMTVEAAAGQLTLEQIAHRLRH

Download         Length: 369 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8306.41 Da        Isoelectric Point: 4.7906

>AT282938 WP_032937236.1 NZ_CP126536:377946-378167 [Citrobacter freundii]
MRTMNYSEARQNLAEVLESAVTGVPVTITRRGHKPAVIISAEEFERYQAARLDDEFADIMMIHGNEIRELADK

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0J1QS94

Antitoxin

Source ID Structure
AlphaFold DB A0A0J1N092

References