Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | ykfI-yfjZ/CbtA-CbeA |
Location | 77520..78202 | Replicon | chromosome |
Accession | NZ_CP126536 | ||
Organism | Citrobacter freundii strain CRNMS1 |
Toxin (Protein)
Gene name | ykfI | Uniprot ID | - |
Locus tag | QOK75_RS00375 | Protein ID | WP_108168483.1 |
Coordinates | 77520..77861 (-) | Length | 114 a.a. |
Antitoxin (Protein)
Gene name | yfjZ | Uniprot ID | - |
Locus tag | QOK75_RS00380 | Protein ID | WP_108168484.1 |
Coordinates | 77882..78202 (-) | Length | 107 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QOK75_RS00355 (74198) | 74198..74725 | - | 528 | WP_134216361.1 | hypothetical protein | - |
QOK75_RS00360 (74772) | 74772..75431 | - | 660 | WP_134216360.1 | antiviral reverse transcriptase Drt3a | - |
QOK75_RS00365 (75455) | 75455..76048 | - | 594 | WP_258982657.1 | SLATT domain-containing protein | - |
QOK75_RS00370 (76573) | 76573..77406 | - | 834 | WP_099530882.1 | DUF4942 domain-containing protein | - |
QOK75_RS00375 (77520) | 77520..77861 | - | 342 | WP_108168483.1 | TA system toxin CbtA family protein | Toxin |
QOK75_RS00380 (77882) | 77882..78202 | - | 321 | WP_108168484.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
QOK75_RS00385 (78221) | 78221..78442 | - | 222 | WP_108168485.1 | DUF987 domain-containing protein | - |
QOK75_RS00390 (78452) | 78452..78928 | - | 477 | WP_108168486.1 | RadC family protein | - |
QOK75_RS00395 (78944) | 78944..79402 | - | 459 | WP_108168487.1 | antirestriction protein | - |
QOK75_RS00400 (79483) | 79483..79719 | - | 237 | WP_108168488.1 | DUF905 domain-containing protein | - |
QOK75_RS00405 (79797) | 79797..80207 | - | 411 | WP_043082399.1 | hypothetical protein | - |
QOK75_RS00410 (80293) | 80293..80907 | - | 615 | WP_108168489.1 | hypothetical protein | - |
QOK75_RS00415 (80904) | 80904..81608 | - | 705 | WP_108168490.1 | WYL domain-containing protein | - |
QOK75_RS00420 (81809) | 81809..82642 | - | 834 | WP_108168491.1 | DUF932 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 71024..89179 | 18155 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 12956.85 Da Isoelectric Point: 7.2015
>T282936 WP_108168483.1 NZ_CP126536:c77861-77520 [Citrobacter freundii]
MKPQPATTSRAAELYLSPVAVWQMLLTRLLEQHYGLTLNDTPFSDETVIQEHIDAGIMLADAVNFLVEKYELVRIDRKGF
SWQEQSPYLRAVDILRARQATGLLRQSRNNAVR
MKPQPATTSRAAELYLSPVAVWQMLLTRLLEQHYGLTLNDTPFSDETVIQEHIDAGIMLADAVNFLVEKYELVRIDRKGF
SWQEQSPYLRAVDILRARQATGLLRQSRNNAVR
Download Length: 342 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|