Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
Location | 1629599..1630234 | Replicon | chromosome |
Accession | NZ_CP126535 | ||
Organism | Paenibacillus sp. PK1-4R |
Toxin (Protein)
Gene name | mazF | Uniprot ID | W4B4V0 |
Locus tag | QNO02_RS06795 | Protein ID | WP_024630714.1 |
Coordinates | 1629884..1630234 (+) | Length | 117 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | W4B5R5 |
Locus tag | QNO02_RS06790 | Protein ID | WP_017690037.1 |
Coordinates | 1629599..1629880 (+) | Length | 94 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QNO02_RS06770 (QNO02_06770) | 1624814..1625926 | - | 1113 | WP_289391520.1 | serine hydrolase | - |
QNO02_RS06775 (QNO02_06775) | 1625827..1626306 | - | 480 | WP_289391521.1 | serine hydrolase | - |
QNO02_RS06780 (QNO02_06780) | 1626556..1627755 | + | 1200 | WP_289391522.1 | DUF4367 domain-containing protein | - |
QNO02_RS06785 (QNO02_06785) | 1628151..1629338 | + | 1188 | WP_091033662.1 | alanine racemase | - |
QNO02_RS06790 (QNO02_06790) | 1629599..1629880 | + | 282 | WP_017690037.1 | ribbon-helix-helix protein, CopG family | Antitoxin |
QNO02_RS06795 (QNO02_06795) | 1629884..1630234 | + | 351 | WP_024630714.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
QNO02_RS06800 (QNO02_06800) | 1630472..1632661 | + | 2190 | WP_289391523.1 | alpha-galactosidase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12778.77 Da Isoelectric Point: 5.1184
>T282935 WP_024630714.1 NZ_CP126535:1629884-1630234 [Paenibacillus sp. PK1-4R]
MIVKRGDVFFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTCIVAAITAQIQKAKLPTHVEIDAAAHGFDRDSVILLEQI
RTIDKQRLTDKITHLDEETMKLVNEALQISLGLIDF
MIVKRGDVFFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTCIVAAITAQIQKAKLPTHVEIDAAAHGFDRDSVILLEQI
RTIDKQRLTDKITHLDEETMKLVNEALQISLGLIDF
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|