Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
Location | 3208442..3209078 | Replicon | chromosome |
Accession | NZ_CP126534 | ||
Organism | Bacillus inaquosorum strain BSY82 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | G4NU33 |
Locus tag | QN218_RS16300 | Protein ID | WP_003156187.1 |
Coordinates | 3208442..3208792 (-) | Length | 117 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | G4NU32 |
Locus tag | QN218_RS16305 | Protein ID | WP_003225183.1 |
Coordinates | 3208797..3209078 (-) | Length | 94 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QN218_RS16260 | 3203486..3204085 | - | 600 | WP_060397967.1 | phosphoserine phosphatase RsbX | - |
QN218_RS16265 | 3204085..3204873 | - | 789 | WP_003240361.1 | RNA polymerase sigma factor SigB | - |
QN218_RS16270 | 3204839..3205321 | - | 483 | WP_003240359.1 | anti-sigma B factor RsbW | - |
QN218_RS16275 | 3205318..3205647 | - | 330 | WP_003240357.1 | anti-sigma factor antagonist RsbV | - |
QN218_RS16280 | 3205709..3206716 | - | 1008 | WP_003240354.1 | phosphoserine phosphatase RsbU | - |
QN218_RS16285 | 3206728..3207129 | - | 402 | WP_003240352.1 | serine/threonine-protein kinase RsbT | - |
QN218_RS16290 | 3207133..3207498 | - | 366 | WP_003225190.1 | RsbT antagonist protein RsbS | - |
QN218_RS16295 | 3207503..3208327 | - | 825 | WP_003240350.1 | RsbT co-antagonist protein RsbRA | - |
QN218_RS16300 | 3208442..3208792 | - | 351 | WP_003156187.1 | type II toxin-antitoxin system endoribonuclease NdoA | Toxin |
QN218_RS16305 | 3208797..3209078 | - | 282 | WP_003225183.1 | type II toxin-antitoxin system antitoxin EndoAI | Antitoxin |
QN218_RS16310 | 3209193..3210362 | - | 1170 | WP_060397966.1 | alanine racemase | - |
QN218_RS16315 | 3210477..3211493 | - | 1017 | WP_080010740.1 | outer membrane lipoprotein carrier protein LolA | - |
QN218_RS16320 | 3211658..3212023 | - | 366 | WP_003240339.1 | holo-ACP synthase | - |
QN218_RS16325 | 3212118..3212717 | + | 600 | WP_003240338.1 | rhomboid family intramembrane serine protease | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12977.98 Da Isoelectric Point: 4.8781
>T282934 WP_003156187.1 NZ_CP126534:c3208792-3208442 [Bacillus inaquosorum]
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDKVDEALQISLALIDF
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDKVDEALQISLALIDF
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|