Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | spoIISABC/SpoIISA-SpoIISB |
Location | 2268609..2269525 | Replicon | chromosome |
Accession | NZ_CP126534 | ||
Organism | Bacillus inaquosorum strain BSY82 |
Toxin (Protein)
Gene name | spoIISA | Uniprot ID | - |
Locus tag | QN218_RS11755 | Protein ID | WP_060398450.1 |
Coordinates | 2268609..2269355 (+) | Length | 249 a.a. |
Antitoxin (Protein)
Gene name | spoIISB | Uniprot ID | G4NV07 |
Locus tag | QN218_RS11760 | Protein ID | WP_003239095.1 |
Coordinates | 2269355..2269525 (+) | Length | 57 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QN218_RS11730 | 2263694..2263839 | - | 146 | Protein_2312 | hypothetical protein | - |
QN218_RS11735 | 2263940..2264890 | - | 951 | WP_060398452.1 | ring-cleaving dioxygenase | - |
QN218_RS11740 | 2265276..2266592 | + | 1317 | WP_060398451.1 | serine/threonine exchanger | - |
QN218_RS11745 | 2266868..2267485 | + | 618 | WP_003218470.1 | DUF47 domain-containing protein | - |
QN218_RS11750 | 2267498..2268499 | + | 1002 | WP_003239093.1 | inorganic phosphate transporter | - |
QN218_RS11755 | 2268609..2269355 | + | 747 | WP_060398450.1 | toxin-antitoxin-antitoxin system toxin SpoIISA | Toxin |
QN218_RS11760 | 2269355..2269525 | + | 171 | WP_003239095.1 | three component toxin-antitoxin-antitoxin system antitoxin SpoIISB | Antitoxin |
QN218_RS11765 | 2269610..2269747 | + | 138 | WP_119913750.1 | three component toxin-antitoxin-antitoxin system antitoxin SpoIISC | - |
QN218_RS11770 | 2269784..2270677 | - | 894 | WP_060398449.1 | N-acetylmuramoyl-L-alanine amidase | - |
QN218_RS11775 | 2270690..2270953 | - | 264 | WP_003239099.1 | phage holin | - |
QN218_RS11780 | 2270966..2271235 | - | 270 | WP_060398448.1 | hemolysin XhlA family protein | - |
QN218_RS11785 | 2271288..2272127 | - | 840 | WP_060398447.1 | hypothetical protein | - |
QN218_RS11790 | 2272174..2272338 | - | 165 | WP_019258164.1 | XkdX family protein | - |
QN218_RS11795 | 2272335..2272664 | - | 330 | WP_060398446.1 | XkdW family protein | - |
QN218_RS11800 | 2272676..2274481 | - | 1806 | WP_250620463.1 | terminase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 249 a.a. Molecular weight: 29097.57 Da Isoelectric Point: 4.6191
>T282933 WP_060398450.1 NZ_CP126534:2268609-2269355 [Bacillus inaquosorum]
MLLFFQIMVWCVMAGLGLYVYATWRFEAKVKEKMSAIRKTWYLLFVLGAMVYWTYEPSSLFTHWERYLIVAVSFALIDAF
IFLSAYVKKLAGSELETDTREILEENNEMLHMYLNRLKTYQYLLKNEPIHVYYGSIDAYAEGIDKLLKTYADKMNLTASL
CHYSTQADKDRLTEHMDDPADVQNRLDRKDVYYDQYGKMVLIPFTIETQSYVIKLTSDSIVTEFDYLLFTSLTSIYDLVL
PIEEEGEG
MLLFFQIMVWCVMAGLGLYVYATWRFEAKVKEKMSAIRKTWYLLFVLGAMVYWTYEPSSLFTHWERYLIVAVSFALIDAF
IFLSAYVKKLAGSELETDTREILEENNEMLHMYLNRLKTYQYLLKNEPIHVYYGSIDAYAEGIDKLLKTYADKMNLTASL
CHYSTQADKDRLTEHMDDPADVQNRLDRKDVYYDQYGKMVLIPFTIETQSYVIKLTSDSIVTEFDYLLFTSLTSIYDLVL
PIEEEGEG
Download Length: 747 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|