Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | spoIISABC/SpoIISA-SpoIISB |
Location | 1352525..1353441 | Replicon | chromosome |
Accession | NZ_CP126530 | ||
Organism | Bacillus halotolerans strain Tehuacan_S4 |
Toxin (Protein)
Gene name | spoIISA | Uniprot ID | - |
Locus tag | QPL78_RS07055 | Protein ID | WP_284560536.1 |
Coordinates | 1352695..1353441 (-) | Length | 249 a.a. |
Antitoxin (Protein)
Gene name | spoIISB | Uniprot ID | A0A7G7U9Y3 |
Locus tag | QPL78_RS07050 | Protein ID | WP_024121090.1 |
Coordinates | 1352525..1352695 (-) | Length | 57 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QPL78_RS07010 (QPL78_07010) | 1348242..1348571 | + | 330 | WP_268498207.1 | XkdW family protein | - |
QPL78_RS07015 (QPL78_07015) | 1348568..1348732 | + | 165 | WP_185848046.1 | XkdX family protein | - |
QPL78_RS07020 (QPL78_07020) | 1348776..1349615 | + | 840 | WP_284560534.1 | phage portal protein | - |
QPL78_RS07025 (QPL78_07025) | 1349671..1349940 | + | 270 | WP_024121085.1 | hemolysin XhlA family protein | - |
QPL78_RS07030 (QPL78_07030) | 1349952..1350215 | + | 264 | WP_024121086.1 | phage holin | - |
QPL78_RS07035 (QPL78_07035) | 1350228..1351124 | + | 897 | WP_268498202.1 | N-acetylmuramoyl-L-alanine amidase | - |
QPL78_RS07040 (QPL78_07040) | 1351201..1352292 | + | 1092 | WP_284560535.1 | acyltransferase family protein | - |
QPL78_RS07045 (QPL78_07045) | 1352289..1352441 | - | 153 | WP_151174960.1 | three component toxin-antitoxin-antitoxin system antitoxin SpoIISC | - |
QPL78_RS07050 (QPL78_07050) | 1352525..1352695 | - | 171 | WP_024121090.1 | type II toxin-antitoxin system SpoIISB family antitoxin | Antitoxin |
QPL78_RS07055 (QPL78_07055) | 1352695..1353441 | - | 747 | WP_284560536.1 | type II toxin-antitoxin system SpoIISA family toxin | Toxin |
QPL78_RS07060 (QPL78_07060) | 1353551..1354552 | - | 1002 | WP_024121092.1 | inorganic phosphate transporter | - |
QPL78_RS07065 (QPL78_07065) | 1354565..1355182 | - | 618 | WP_010333926.1 | DUF47 domain-containing protein | - |
QPL78_RS07070 (QPL78_07070) | 1355458..1356774 | - | 1317 | WP_284560537.1 | serine/threonine exchanger | - |
QPL78_RS07075 (QPL78_07075) | 1357169..1358119 | + | 951 | WP_105990669.1 | ring-cleaving dioxygenase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 249 a.a. Molecular weight: 29110.50 Da Isoelectric Point: 4.4986
>T282932 WP_284560536.1 NZ_CP126530:c1353441-1352695 [Bacillus halotolerans]
MLLFFQIMVWCTMAALGLYVYATWRFEAKVKEKMSAIRKTWYLLFVFGAMIYWTYDPSSLFTNWERYVIVAVSFALIDAF
IFLSAYVKKLAGSELETDTREILEENNEMLHMYLDRLKTYQYLLKNEPIHVYYGSIEAYAEGIDKLLKTYADKMNLTASL
CHYSTQSDKDRLTEHMEDPADVQTRLDRKDVYYDQYGKVVLIPFTIETQSYVIKLTSDSIVTEFDYLLFTSLTSIYDLVL
PIEEEGEG
MLLFFQIMVWCTMAALGLYVYATWRFEAKVKEKMSAIRKTWYLLFVFGAMIYWTYDPSSLFTNWERYVIVAVSFALIDAF
IFLSAYVKKLAGSELETDTREILEENNEMLHMYLDRLKTYQYLLKNEPIHVYYGSIEAYAEGIDKLLKTYADKMNLTASL
CHYSTQSDKDRLTEHMEDPADVQTRLDRKDVYYDQYGKVVLIPFTIETQSYVIKLTSDSIVTEFDYLLFTSLTSIYDLVL
PIEEEGEG
Download Length: 747 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|