Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
Location | 526456..527092 | Replicon | chromosome |
Accession | NZ_CP126530 | ||
Organism | Bacillus halotolerans strain Tehuacan_S4 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | G4NU33 |
Locus tag | QPL78_RS02675 | Protein ID | WP_003156187.1 |
Coordinates | 526742..527092 (+) | Length | 117 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | G4NU32 |
Locus tag | QPL78_RS02670 | Protein ID | WP_003225183.1 |
Coordinates | 526456..526737 (+) | Length | 94 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QPL78_RS02650 (QPL78_02650) | 522811..523410 | - | 600 | WP_024120294.1 | rhomboid family intramembrane serine protease | - |
QPL78_RS02655 (QPL78_02655) | 523505..523870 | + | 366 | WP_101864032.1 | holo-ACP synthase | - |
QPL78_RS02660 (QPL78_02660) | 524036..525052 | + | 1017 | WP_284560745.1 | outer membrane lipoprotein carrier protein LolA | - |
QPL78_RS02665 (QPL78_02665) | 525169..526338 | + | 1170 | WP_284560212.1 | alanine racemase | - |
QPL78_RS02670 (QPL78_02670) | 526456..526737 | + | 282 | WP_003225183.1 | type II toxin-antitoxin system antitoxin EndoAI | Antitoxin |
QPL78_RS02675 (QPL78_02675) | 526742..527092 | + | 351 | WP_003156187.1 | type II toxin-antitoxin system endoribonuclease NdoA | Toxin |
QPL78_RS02680 (QPL78_02680) | 527207..528031 | + | 825 | WP_081638235.1 | RsbT co-antagonist protein RsbRA | - |
QPL78_RS02685 (QPL78_02685) | 528036..528401 | + | 366 | WP_003225190.1 | RsbT antagonist protein RsbS | - |
QPL78_RS02690 (QPL78_02690) | 528405..528806 | + | 402 | WP_024120299.1 | serine/threonine-protein kinase RsbT | - |
QPL78_RS02695 (QPL78_02695) | 528818..529825 | + | 1008 | WP_024120300.1 | phosphoserine phosphatase RsbU | - |
QPL78_RS02700 (QPL78_02700) | 529886..530215 | + | 330 | WP_024120301.1 | anti-sigma factor antagonist RsbV | - |
QPL78_RS02705 (QPL78_02705) | 530212..530694 | + | 483 | WP_024120302.1 | anti-sigma B factor RsbW | - |
QPL78_RS02710 (QPL78_02710) | 530660..531448 | + | 789 | WP_024120303.1 | RNA polymerase sigma factor SigB | - |
QPL78_RS02715 (QPL78_02715) | 531448..532047 | + | 600 | WP_024120304.1 | phosphoserine phosphatase RsbX | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12977.98 Da Isoelectric Point: 4.8781
>T282931 WP_003156187.1 NZ_CP126530:526742-527092 [Bacillus halotolerans]
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDKVDEALQISLALIDF
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDKVDEALQISLALIDF
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|