Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | /SpoIISA(toxin) |
| Location | 2312318..2313296 | Replicon | chromosome |
| Accession | NZ_CP126525 | ||
| Organism | Bacillus toyonensis strain Puebla_S2 | ||
Toxin (Protein)
| Gene name | spoIISA | Uniprot ID | K0FNW8 |
| Locus tag | QPL84_RS11855 | Protein ID | WP_000155917.1 |
| Coordinates | 2312318..2313058 (+) | Length | 247 a.a. |
Antitoxin (Protein)
| Gene name | - | Uniprot ID | J8KE32 |
| Locus tag | QPL84_RS11860 | Protein ID | WP_000588713.1 |
| Coordinates | 2313171..2313296 (+) | Length | 42 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QPL84_RS11835 (QPL84_11835) | 2307980..2308762 | + | 783 | WP_185777487.1 | class I SAM-dependent methyltransferase | - |
| QPL84_RS11840 (QPL84_11840) | 2308941..2310617 | - | 1677 | WP_284558607.1 | alpha-keto acid decarboxylase family protein | - |
| QPL84_RS11845 (QPL84_11845) | 2310744..2311226 | + | 483 | WP_000191892.1 | MarR family winged helix-turn-helix transcriptional regulator | - |
| QPL84_RS11850 (QPL84_11850) | 2311394..2312131 | + | 738 | WP_000594132.1 | 2,3-diphosphoglycerate-dependent phosphoglycerate mutase | - |
| QPL84_RS11855 (QPL84_11855) | 2312318..2313058 | + | 741 | WP_000155917.1 | type II toxin-antitoxin system SpoIISA family toxin | Toxin |
| QPL84_RS11860 (QPL84_11860) | 2313171..2313296 | + | 126 | WP_000588713.1 | hypothetical protein | Antitoxin |
| QPL84_RS11865 (QPL84_11865) | 2313372..2313548 | + | 177 | WP_000808012.1 | stage II sporulation protein SB | - |
| QPL84_RS11870 (QPL84_11870) | 2313597..2313986 | - | 390 | WP_284558608.1 | YxeA family protein | - |
| QPL84_RS11875 (QPL84_11875) | 2314230..2315699 | + | 1470 | WP_284558609.1 | beta-Ala-His dipeptidase | - |
| QPL84_RS11880 (QPL84_11880) | 2316010..2316819 | + | 810 | WP_000678381.1 | papain-like cysteine protease family protein | - |
| QPL84_RS11885 (QPL84_11885) | 2316847..2317449 | + | 603 | WP_000517300.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 247 a.a. Molecular weight: 28446.03 Da Isoelectric Point: 7.3946
>T282930 WP_000155917.1 NZ_CP126525:2312318-2313058 [Bacillus toyonensis]
MTISNIRIGLFILAIVFVVLVFFYWRNEELYEEKKQRIRKTWYGLFITSVTVYFMIKGIDLTLWKNLLMFTAMVIFVDIS
FILTPNISEIWGAKFSDIGKTVQSIKRSLIASKARGEIYTNIIQNINPAAFGTMEWHTEEEYTKSLNTFLDSYGEKIGAK
IVVFEAANELNTGFRGIRSQFSITIPIEHIEQLNEQKAVQVENVGIIPAKIMNDVFIVIDGKKNSLQDRDFENVYNLTIH
HSYFSK
MTISNIRIGLFILAIVFVVLVFFYWRNEELYEEKKQRIRKTWYGLFITSVTVYFMIKGIDLTLWKNLLMFTAMVIFVDIS
FILTPNISEIWGAKFSDIGKTVQSIKRSLIASKARGEIYTNIIQNINPAAFGTMEWHTEEEYTKSLNTFLDSYGEKIGAK
IVVFEAANELNTGFRGIRSQFSITIPIEHIEQLNEQKAVQVENVGIIPAKIMNDVFIVIDGKKNSLQDRDFENVYNLTIH
HSYFSK
Download Length: 741 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|