Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | pemIK/MazF(toxin) |
Location | 238573..239215 | Replicon | chromosome |
Accession | NZ_CP126525 | ||
Organism | Bacillus toyonensis strain Puebla_S2 |
Toxin (Protein)
Gene name | pemK | Uniprot ID | J8CWW5 |
Locus tag | QPL84_RS01370 | Protein ID | WP_000635963.1 |
Coordinates | 238865..239215 (+) | Length | 117 a.a. |
Antitoxin (Protein)
Gene name | pemI | Uniprot ID | R8I8H2 |
Locus tag | QPL84_RS01365 | Protein ID | WP_000004570.1 |
Coordinates | 238573..238860 (+) | Length | 96 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QPL84_RS01340 (QPL84_01340) | 233900..234862 | + | 963 | WP_000961174.1 | UV DNA damage repair endonuclease UvsE | - |
QPL84_RS01345 (QPL84_01345) | 234855..235427 | - | 573 | WP_000908503.1 | rhomboid family intramembrane serine protease | - |
QPL84_RS01350 (QPL84_01350) | 235520..235879 | + | 360 | WP_000635048.1 | holo-ACP synthase | - |
QPL84_RS01355 (QPL84_01355) | 236036..236986 | + | 951 | WP_002037834.1 | outer membrane lipoprotein carrier protein LolA | - |
QPL84_RS01360 (QPL84_01360) | 237104..238273 | + | 1170 | WP_000390621.1 | alanine racemase | - |
QPL84_RS01365 (QPL84_01365) | 238573..238860 | + | 288 | WP_000004570.1 | antitoxin EndoAI | Antitoxin |
QPL84_RS01370 (QPL84_01370) | 238865..239215 | + | 351 | WP_000635963.1 | type II toxin-antitoxin system endoribonuclease NdoA | Toxin |
QPL84_RS01375 (QPL84_01375) | 239284..241452 | + | 2169 | WP_141495663.1 | Tex family protein | - |
QPL84_RS01380 (QPL84_01380) | 241511..241627 | - | 117 | WP_001143642.1 | cortex morphogenetic protein CmpA | - |
QPL84_RS01385 (QPL84_01385) | 241835..242311 | + | 477 | WP_097838208.1 | SprT family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12974.12 Da Isoelectric Point: 5.7168
>T282929 WP_000635963.1 NZ_CP126525:238865-239215 [Bacillus toyonensis]
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTVIVAAITAQIQKAKLPTHVEIDAKKYGFERDSVILLEQI
RTIDKQRLTDKITHLDEVMMIRVDEALQISLGLIDF
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTVIVAAITAQIQKAKLPTHVEIDAKKYGFERDSVILLEQI
RTIDKQRLTDKITHLDEVMMIRVDEALQISLGLIDF
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
PDB | 4HKE | |
PDB | 7BXY |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A366FY90 |