Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | /SpoIISA(toxin) |
| Location | 2423067..2424045 | Replicon | chromosome |
| Accession | NZ_CP126524 | ||
| Organism | Bacillus toyonensis strain Monterrey_S3 | ||
Toxin (Protein)
| Gene name | spoIISA | Uniprot ID | K0FNW8 |
| Locus tag | QPL83_RS14095 | Protein ID | WP_000155917.1 |
| Coordinates | 2423067..2423807 (+) | Length | 247 a.a. |
Antitoxin (Protein)
| Gene name | - | Uniprot ID | J8KE32 |
| Locus tag | QPL83_RS14100 | Protein ID | WP_000588713.1 |
| Coordinates | 2423920..2424045 (+) | Length | 42 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QPL83_RS14075 (QPL83_14075) | 2418727..2419509 | + | 783 | Protein_2370 | class I SAM-dependent methyltransferase | - |
| QPL83_RS14080 (QPL83_14080) | 2419690..2421366 | - | 1677 | WP_284555930.1 | alpha-keto acid decarboxylase family protein | - |
| QPL83_RS14085 (QPL83_14085) | 2421493..2421975 | + | 483 | WP_000191892.1 | MarR family winged helix-turn-helix transcriptional regulator | - |
| QPL83_RS14090 (QPL83_14090) | 2422143..2422880 | + | 738 | WP_000594132.1 | 2,3-diphosphoglycerate-dependent phosphoglycerate mutase | - |
| QPL83_RS14095 (QPL83_14095) | 2423067..2423807 | + | 741 | WP_000155917.1 | type II toxin-antitoxin system SpoIISA family toxin | Toxin |
| QPL83_RS14100 (QPL83_14100) | 2423920..2424045 | + | 126 | WP_000588713.1 | hypothetical protein | Antitoxin |
| QPL83_RS14105 (QPL83_14105) | 2424121..2424297 | + | 177 | WP_000808012.1 | stage II sporulation protein SB | - |
| QPL83_RS14110 (QPL83_14110) | 2424346..2424735 | - | 390 | WP_000732294.1 | YxeA family protein | - |
| QPL83_RS14115 (QPL83_14115) | 2424979..2426448 | + | 1470 | WP_284555931.1 | beta-Ala-His dipeptidase | - |
| QPL83_RS14120 (QPL83_14120) | 2426759..2427568 | + | 810 | WP_000678381.1 | papain-like cysteine protease family protein | - |
| QPL83_RS14125 (QPL83_14125) | 2427596..2428198 | + | 603 | WP_284555932.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 247 a.a. Molecular weight: 28446.03 Da Isoelectric Point: 7.3946
>T282928 WP_000155917.1 NZ_CP126524:2423067-2423807 [Bacillus toyonensis]
MTISNIRIGLFILAIVFVVLVFFYWRNEELYEEKKQRIRKTWYGLFITSVTVYFMIKGIDLTLWKNLLMFTAMVIFVDIS
FILTPNISEIWGAKFSDIGKTVQSIKRSLIASKARGEIYTNIIQNINPAAFGTMEWHTEEEYTKSLNTFLDSYGEKIGAK
IVVFEAANELNTGFRGIRSQFSITIPIEHIEQLNEQKAVQVENVGIIPAKIMNDVFIVIDGKKNSLQDRDFENVYNLTIH
HSYFSK
MTISNIRIGLFILAIVFVVLVFFYWRNEELYEEKKQRIRKTWYGLFITSVTVYFMIKGIDLTLWKNLLMFTAMVIFVDIS
FILTPNISEIWGAKFSDIGKTVQSIKRSLIASKARGEIYTNIIQNINPAAFGTMEWHTEEEYTKSLNTFLDSYGEKIGAK
IVVFEAANELNTGFRGIRSQFSITIPIEHIEQLNEQKAVQVENVGIIPAKIMNDVFIVIDGKKNSLQDRDFENVYNLTIH
HSYFSK
Download Length: 741 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|