Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | pemIK/MazF(toxin) |
Location | 238273..238915 | Replicon | chromosome |
Accession | NZ_CP126524 | ||
Organism | Bacillus toyonensis strain Monterrey_S3 |
Toxin (Protein)
Gene name | pemK | Uniprot ID | J8CWW5 |
Locus tag | QPL83_RS02990 | Protein ID | WP_000635963.1 |
Coordinates | 238565..238915 (+) | Length | 117 a.a. |
Antitoxin (Protein)
Gene name | pemI | Uniprot ID | R8I8H2 |
Locus tag | QPL83_RS02985 | Protein ID | WP_000004570.1 |
Coordinates | 238273..238560 (+) | Length | 96 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QPL83_RS02960 (QPL83_02960) | 233600..234562 | + | 963 | WP_000961174.1 | UV DNA damage repair endonuclease UvsE | - |
QPL83_RS02965 (QPL83_02965) | 234555..235127 | - | 573 | WP_000908503.1 | rhomboid family intramembrane serine protease | - |
QPL83_RS02970 (QPL83_02970) | 235220..235579 | + | 360 | WP_000635048.1 | holo-ACP synthase | - |
QPL83_RS02975 (QPL83_02975) | 235736..236686 | + | 951 | WP_002037834.1 | outer membrane lipoprotein carrier protein LolA | - |
QPL83_RS02980 (QPL83_02980) | 236804..237973 | + | 1170 | WP_000390621.1 | alanine racemase | - |
QPL83_RS02985 (QPL83_02985) | 238273..238560 | + | 288 | WP_000004570.1 | antitoxin EndoAI | Antitoxin |
QPL83_RS02990 (QPL83_02990) | 238565..238915 | + | 351 | WP_000635963.1 | type II toxin-antitoxin system endoribonuclease NdoA | Toxin |
QPL83_RS02995 (QPL83_02995) | 238984..241152 | + | 2169 | WP_000426215.1 | Tex family protein | - |
QPL83_RS03000 (QPL83_03000) | 241211..241327 | - | 117 | WP_001143642.1 | cortex morphogenetic protein CmpA | - |
QPL83_RS03005 (QPL83_03005) | 241535..242002 | + | 468 | WP_000544525.1 | SprT family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12974.12 Da Isoelectric Point: 5.7168
>T282927 WP_000635963.1 NZ_CP126524:238565-238915 [Bacillus toyonensis]
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTVIVAAITAQIQKAKLPTHVEIDAKKYGFERDSVILLEQI
RTIDKQRLTDKITHLDEVMMIRVDEALQISLGLIDF
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTVIVAAITAQIQKAKLPTHVEIDAKKYGFERDSVILLEQI
RTIDKQRLTDKITHLDEVMMIRVDEALQISLGLIDF
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
PDB | 4HKE | |
PDB | 7BXY |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A366FY90 |