Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
Location | 521418..522054 | Replicon | chromosome |
Accession | NZ_CP126521 | ||
Organism | Bacillus pumilus strain Monterrey_S2 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | K2MHT4 |
Locus tag | QPL77_RS02510 | Protein ID | WP_003214169.1 |
Coordinates | 521704..522054 (+) | Length | 117 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | A0A267X601 |
Locus tag | QPL77_RS02505 | Protein ID | WP_012008995.1 |
Coordinates | 521418..521699 (+) | Length | 94 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QPL77_RS02485 (QPL77_02485) | 517398..518003 | - | 606 | WP_144522255.1 | rhomboid family intramembrane serine protease | - |
QPL77_RS02490 (QPL77_02490) | 518098..518463 | + | 366 | WP_211063298.1 | holo-ACP synthase | - |
QPL77_RS02495 (QPL77_02495) | 518624..519640 | + | 1017 | WP_088004450.1 | outer membrane lipoprotein carrier protein LolA | - |
QPL77_RS02500 (QPL77_02500) | 519943..521121 | + | 1179 | WP_211063297.1 | alanine racemase | - |
QPL77_RS02505 (QPL77_02505) | 521418..521699 | + | 282 | WP_012008995.1 | hypothetical protein | Antitoxin |
QPL77_RS02510 (QPL77_02510) | 521704..522054 | + | 351 | WP_003214169.1 | type II toxin-antitoxin system endoribonuclease NdoA | Toxin |
QPL77_RS02515 (QPL77_02515) | 522169..522999 | + | 831 | WP_012008996.1 | RsbT co-antagonist protein RsbRA | - |
QPL77_RS02520 (QPL77_02520) | 523004..523372 | + | 369 | WP_003214235.1 | RsbT antagonist protein RsbS | - |
QPL77_RS02525 (QPL77_02525) | 523375..523776 | + | 402 | WP_003214085.1 | anti-sigma regulatory factor | - |
QPL77_RS02530 (QPL77_02530) | 523787..524794 | + | 1008 | WP_144522260.1 | PP2C family protein-serine/threonine phosphatase | - |
QPL77_RS02535 (QPL77_02535) | 524854..525183 | + | 330 | WP_012008998.1 | anti-sigma factor antagonist | - |
QPL77_RS02540 (QPL77_02540) | 525180..525668 | + | 489 | WP_012008999.1 | anti-sigma B factor RsbW | - |
QPL77_RS02545 (QPL77_02545) | 525634..526422 | + | 789 | WP_012009000.1 | RNA polymerase sigma factor SigB | - |
QPL77_RS02550 (QPL77_02550) | 526422..527021 | + | 600 | WP_211063296.1 | PP2C family serine/threonine-protein phosphatase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12976.99 Da Isoelectric Point: 5.1663
>T282926 WP_003214169.1 NZ_CP126521:521704-522054 [Bacillus pumilus]
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEINAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMEKVDEALQVSLALIDF
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEINAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMEKVDEALQVSLALIDF
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | K2MHT4 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A267X601 |