Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | /SpoIISA(toxin) |
| Location | 2320427..2321405 | Replicon | chromosome |
| Accession | NZ_CP126520 | ||
| Organism | Bacillus toyonensis strain Cuernavaca_S4 | ||
Toxin (Protein)
| Gene name | spoIISA | Uniprot ID | K0FNW8 |
| Locus tag | QPL81_RS14125 | Protein ID | WP_000155917.1 |
| Coordinates | 2320427..2321167 (+) | Length | 247 a.a. |
Antitoxin (Protein)
| Gene name | - | Uniprot ID | J8KE32 |
| Locus tag | QPL81_RS14130 | Protein ID | WP_000588713.1 |
| Coordinates | 2321280..2321405 (+) | Length | 42 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QPL81_RS14105 (QPL81_14105) | 2316087..2316869 | + | 783 | WP_000381781.1 | class I SAM-dependent methyltransferase | - |
| QPL81_RS14110 (QPL81_14110) | 2317050..2318726 | - | 1677 | WP_284557501.1 | alpha-keto acid decarboxylase family protein | - |
| QPL81_RS14115 (QPL81_14115) | 2318853..2319335 | + | 483 | WP_000191892.1 | MarR family winged helix-turn-helix transcriptional regulator | - |
| QPL81_RS14120 (QPL81_14120) | 2319503..2320240 | + | 738 | WP_000594132.1 | 2,3-diphosphoglycerate-dependent phosphoglycerate mutase | - |
| QPL81_RS14125 (QPL81_14125) | 2320427..2321167 | + | 741 | WP_000155917.1 | type II toxin-antitoxin system SpoIISA family toxin | Toxin |
| QPL81_RS14130 (QPL81_14130) | 2321280..2321405 | + | 126 | WP_000588713.1 | hypothetical protein | Antitoxin |
| QPL81_RS14135 (QPL81_14135) | 2321481..2321657 | + | 177 | WP_000808012.1 | stage II sporulation protein SB | - |
| QPL81_RS14140 (QPL81_14140) | 2321706..2322095 | - | 390 | WP_000732294.1 | YxeA family protein | - |
| QPL81_RS14145 (QPL81_14145) | 2322339..2323808 | + | 1470 | WP_284557502.1 | beta-Ala-His dipeptidase | - |
| QPL81_RS14150 (QPL81_14150) | 2324119..2324928 | + | 810 | WP_000678381.1 | papain-like cysteine protease family protein | - |
| QPL81_RS14155 (QPL81_14155) | 2324956..2325558 | + | 603 | WP_097895978.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 247 a.a. Molecular weight: 28446.03 Da Isoelectric Point: 7.3946
>T282925 WP_000155917.1 NZ_CP126520:2320427-2321167 [Bacillus toyonensis]
MTISNIRIGLFILAIVFVVLVFFYWRNEELYEEKKQRIRKTWYGLFITSVTVYFMIKGIDLTLWKNLLMFTAMVIFVDIS
FILTPNISEIWGAKFSDIGKTVQSIKRSLIASKARGEIYTNIIQNINPAAFGTMEWHTEEEYTKSLNTFLDSYGEKIGAK
IVVFEAANELNTGFRGIRSQFSITIPIEHIEQLNEQKAVQVENVGIIPAKIMNDVFIVIDGKKNSLQDRDFENVYNLTIH
HSYFSK
MTISNIRIGLFILAIVFVVLVFFYWRNEELYEEKKQRIRKTWYGLFITSVTVYFMIKGIDLTLWKNLLMFTAMVIFVDIS
FILTPNISEIWGAKFSDIGKTVQSIKRSLIASKARGEIYTNIIQNINPAAFGTMEWHTEEEYTKSLNTFLDSYGEKIGAK
IVVFEAANELNTGFRGIRSQFSITIPIEHIEQLNEQKAVQVENVGIIPAKIMNDVFIVIDGKKNSLQDRDFENVYNLTIH
HSYFSK
Download Length: 741 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|