Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | pemIK/MazF(toxin) |
| Location | 238295..238937 | Replicon | chromosome |
| Accession | NZ_CP126520 | ||
| Organism | Bacillus toyonensis strain Cuernavaca_S4 | ||
Toxin (Protein)
| Gene name | pemK | Uniprot ID | J8CWW5 |
| Locus tag | QPL81_RS03635 | Protein ID | WP_000635963.1 |
| Coordinates | 238587..238937 (+) | Length | 117 a.a. |
Antitoxin (Protein)
| Gene name | pemI | Uniprot ID | R8I8H2 |
| Locus tag | QPL81_RS03630 | Protein ID | WP_000004570.1 |
| Coordinates | 238295..238582 (+) | Length | 96 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QPL81_RS03605 (QPL81_03605) | 233622..234584 | + | 963 | WP_284557181.1 | UV DNA damage repair endonuclease UvsE | - |
| QPL81_RS03610 (QPL81_03610) | 234577..235149 | - | 573 | WP_000908503.1 | rhomboid family intramembrane serine protease | - |
| QPL81_RS03615 (QPL81_03615) | 235242..235601 | + | 360 | WP_000635049.1 | holo-ACP synthase | - |
| QPL81_RS03620 (QPL81_03620) | 235758..236708 | + | 951 | WP_002037834.1 | outer membrane lipoprotein carrier protein LolA | - |
| QPL81_RS03625 (QPL81_03625) | 236826..237995 | + | 1170 | WP_284557182.1 | alanine racemase | - |
| QPL81_RS03630 (QPL81_03630) | 238295..238582 | + | 288 | WP_000004570.1 | antitoxin EndoAI | Antitoxin |
| QPL81_RS03635 (QPL81_03635) | 238587..238937 | + | 351 | WP_000635963.1 | type II toxin-antitoxin system endoribonuclease NdoA | Toxin |
| QPL81_RS03640 (QPL81_03640) | 239006..241174 | + | 2169 | WP_141495663.1 | Tex family protein | - |
| QPL81_RS03645 (QPL81_03645) | 241233..241349 | - | 117 | WP_001143642.1 | cortex morphogenetic protein CmpA | - |
| QPL81_RS03650 (QPL81_03650) | 241557..242033 | + | 477 | WP_097838208.1 | SprT family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12974.12 Da Isoelectric Point: 5.7168
>T282924 WP_000635963.1 NZ_CP126520:238587-238937 [Bacillus toyonensis]
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTVIVAAITAQIQKAKLPTHVEIDAKKYGFERDSVILLEQI
RTIDKQRLTDKITHLDEVMMIRVDEALQISLGLIDF
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTVIVAAITAQIQKAKLPTHVEIDAKKYGFERDSVILLEQI
RTIDKQRLTDKITHLDEVMMIRVDEALQISLGLIDF
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| PDB | 4HKE | |
| PDB | 7BXY |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A366FY90 |