Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | /SpoIISA(toxin) |
| Location | 2367835..2368810 | Replicon | chromosome |
| Accession | NZ_CP126515 | ||
| Organism | Bacillus anthracis strain Mn106-1 head2 chi | ||
Toxin (Protein)
| Gene name | spoIISA | Uniprot ID | - |
| Locus tag | QPL80_RS12975 | Protein ID | WP_284566365.1 |
| Coordinates | 2367835..2368572 (+) | Length | 246 a.a. |
Antitoxin (Protein)
| Gene name | - | Uniprot ID | A0A1J9W3Q2 |
| Locus tag | QPL80_RS12980 | Protein ID | WP_000594606.1 |
| Coordinates | 2368685..2368810 (+) | Length | 42 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QPL80_RS12945 (QPL80_12980) | 2362910..2363620 | + | 711 | WP_071729146.1 | class I SAM-dependent methyltransferase | - |
| QPL80_RS12950 (QPL80_12985) | 2363740..2364147 | + | 408 | WP_088312951.1 | VOC family protein | - |
| QPL80_RS12955 (QPL80_12990) | 2364253..2364345 | + | 93 | Protein_2360 | methyltransferase | - |
| QPL80_RS12960 (QPL80_12995) | 2364467..2366152 | - | 1686 | WP_284566284.1 | alpha-keto acid decarboxylase family protein | - |
| QPL80_RS12965 (QPL80_13000) | 2366259..2366741 | + | 483 | WP_000191911.1 | MarR family winged helix-turn-helix transcriptional regulator | - |
| QPL80_RS12970 (QPL80_13005) | 2366909..2367646 | + | 738 | WP_088312955.1 | 2,3-diphosphoglycerate-dependent phosphoglycerate mutase | - |
| QPL80_RS12975 (QPL80_13010) | 2367835..2368572 | + | 738 | WP_284566365.1 | type II toxin-antitoxin system SpoIISA family toxin | Toxin |
| QPL80_RS12980 (QPL80_13015) | 2368685..2368810 | + | 126 | WP_000594606.1 | hypothetical protein | Antitoxin |
| QPL80_RS12985 (QPL80_13020) | 2368886..2369062 | + | 177 | WP_000852613.1 | stage II sporulation protein SB | - |
| QPL80_RS12990 (QPL80_13025) | 2369106..2369381 | - | 276 | WP_001041552.1 | hypothetical protein | - |
| QPL80_RS12995 (QPL80_13030) | 2369661..2369898 | - | 238 | Protein_2368 | hypothetical protein | - |
| QPL80_RS13000 (QPL80_13035) | 2370035..2370160 | + | 126 | WP_284566285.1 | hypothetical protein | - |
| QPL80_RS13005 (QPL80_13040) | 2370236..2370412 | + | 177 | WP_284566286.1 | stage II sporulation protein SB | - |
| QPL80_RS13010 (QPL80_13045) | 2370556..2372025 | + | 1470 | WP_284566287.1 | beta-Ala-His dipeptidase | - |
| QPL80_RS13015 (QPL80_13050) | 2372606..2373076 | - | 471 | WP_000771836.1 | DUF5065 family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 246 a.a. Molecular weight: 28357.07 Da Isoelectric Point: 8.2269
>T282923 WP_284566365.1 NZ_CP126515:2367835-2368572 [Bacillus anthracis]
VISNIRIGLFILAIVFLVLVFFYWKNEELYEEKKQRIRKTWYGLFIISVTVYFMIKGIDLTLWKNLLMFTAMVIFVDIAF
ILTPNISEIWGAKFSDIGKTVQSIKRSLIASKARGEIYTTIIQNVNPAVFGTMEWYTEEEYTKSLNAFLDSYGEKIGAKI
VVFEAAKELNTNFRGIRSQFSTIIPLEYIEQLNEQKAVQVENVGIIPAKIVSDVFIVIDGKKNNLQDRDFENVYNLTIHH
SYFSK
VISNIRIGLFILAIVFLVLVFFYWKNEELYEEKKQRIRKTWYGLFIISVTVYFMIKGIDLTLWKNLLMFTAMVIFVDIAF
ILTPNISEIWGAKFSDIGKTVQSIKRSLIASKARGEIYTTIIQNVNPAVFGTMEWYTEEEYTKSLNAFLDSYGEKIGAKI
VVFEAAKELNTNFRGIRSQFSTIIPLEYIEQLNEQKAVQVENVGIIPAKIVSDVFIVIDGKKNNLQDRDFENVYNLTIHH
SYFSK
Download Length: 738 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|