Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | pemIK/MazF(toxin) |
| Location | 260007..260649 | Replicon | chromosome |
| Accession | NZ_CP126515 | ||
| Organism | Bacillus anthracis strain Mn106-1 head2 chi | ||
Toxin (Protein)
| Gene name | pemK | Uniprot ID | J8CWW5 |
| Locus tag | QPL80_RS02005 | Protein ID | WP_000635963.1 |
| Coordinates | 260299..260649 (+) | Length | 117 a.a. |
Antitoxin (Protein)
| Gene name | pemI | Uniprot ID | R8I8H2 |
| Locus tag | QPL80_RS02000 | Protein ID | WP_000004570.1 |
| Coordinates | 260007..260294 (+) | Length | 96 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QPL80_RS01975 (QPL80_01975) | 255323..256285 | + | 963 | WP_000961148.1 | UV DNA damage repair endonuclease UvsE | - |
| QPL80_RS01980 (QPL80_01980) | 256278..256850 | - | 573 | WP_071728601.1 | rhomboid family intramembrane serine protease | - |
| QPL80_RS01985 (QPL80_01985) | 256943..257302 | + | 360 | WP_000635047.1 | holo-ACP synthase | - |
| QPL80_RS01990 (QPL80_01990) | 257459..258409 | + | 951 | WP_025388382.1 | outer membrane lipoprotein carrier protein LolA | - |
| QPL80_RS01995 (QPL80_01995) | 258528..259697 | + | 1170 | WP_000390607.1 | alanine racemase | - |
| QPL80_RS02000 (QPL80_02000) | 260007..260294 | + | 288 | WP_000004570.1 | antitoxin EndoAI | Antitoxin |
| QPL80_RS02005 (QPL80_02005) | 260299..260649 | + | 351 | WP_000635963.1 | type II toxin-antitoxin system endoribonuclease NdoA | Toxin |
| QPL80_RS02010 (QPL80_02010) | 260717..262885 | + | 2169 | WP_071728600.1 | Tex family protein | - |
| QPL80_RS02015 (QPL80_02015) | 262943..263059 | - | 117 | WP_001143642.1 | cortex morphogenetic protein CmpA | - |
| QPL80_RS02020 (QPL80_02020) | 263255..263713 | + | 459 | WP_071728599.1 | SprT family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12974.12 Da Isoelectric Point: 5.7168
>T282922 WP_000635963.1 NZ_CP126515:260299-260649 [Bacillus anthracis]
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTVIVAAITAQIQKAKLPTHVEIDAKKYGFERDSVILLEQI
RTIDKQRLTDKITHLDEVMMIRVDEALQISLGLIDF
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTVIVAAITAQIQKAKLPTHVEIDAKKYGFERDSVILLEQI
RTIDKQRLTDKITHLDEVMMIRVDEALQISLGLIDF
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| PDB | 4HKE | |
| PDB | 7BXY |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A366FY90 |