Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
| Location | 1261693..1262329 | Replicon | chromosome |
| Accession | NZ_CP126496 | ||
| Organism | Bacillus paralicheniformis strain DY4 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | M5P3Q9 |
| Locus tag | QN340_RS06195 | Protein ID | WP_003179128.1 |
| Coordinates | 1261979..1262329 (+) | Length | 117 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | M5PDU2 |
| Locus tag | QN340_RS06190 | Protein ID | WP_006638778.1 |
| Coordinates | 1261693..1261974 (+) | Length | 94 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QN340_RS06170 (QN340_06170) | 1256803..1258287 | + | 1485 | WP_041817155.1 | PH domain-containing protein | - |
| QN340_RS06175 (QN340_06175) | 1258284..1258883 | - | 600 | WP_020450255.1 | rhomboid family intramembrane serine protease | - |
| QN340_RS06180 (QN340_06180) | 1259227..1260186 | + | 960 | WP_165395380.1 | outer membrane lipoprotein carrier protein LolA | - |
| QN340_RS06185 (QN340_06185) | 1260412..1261581 | + | 1170 | WP_041817156.1 | alanine racemase | - |
| QN340_RS06190 (QN340_06190) | 1261693..1261974 | + | 282 | WP_006638778.1 | hypothetical protein | Antitoxin |
| QN340_RS06195 (QN340_06195) | 1261979..1262329 | + | 351 | WP_003179128.1 | type II toxin-antitoxin system endoribonuclease NdoA | Toxin |
| QN340_RS06200 (QN340_06200) | 1262447..1263274 | + | 828 | WP_020450258.1 | RsbT co-antagonist protein RsbRA | - |
| QN340_RS06205 (QN340_06205) | 1263278..1263643 | + | 366 | WP_020450259.1 | STAS domain-containing protein | - |
| QN340_RS06210 (QN340_06210) | 1263646..1264047 | + | 402 | WP_020450260.1 | anti-sigma regulatory factor | - |
| QN340_RS06215 (QN340_06215) | 1264058..1265065 | + | 1008 | WP_020450261.1 | PP2C family protein-serine/threonine phosphatase | - |
| QN340_RS06220 (QN340_06220) | 1265124..1265450 | + | 327 | WP_020450262.1 | anti-sigma factor antagonist | - |
| QN340_RS06225 (QN340_06225) | 1265450..1265932 | + | 483 | WP_020450263.1 | anti-sigma B factor RsbW | - |
| QN340_RS06230 (QN340_06230) | 1265898..1266689 | + | 792 | WP_023857858.1 | RNA polymerase sigma factor SigB | - |
| QN340_RS06235 (QN340_06235) | 1266686..1267285 | + | 600 | WP_020450265.1 | PP2C family serine/threonine-protein phosphatase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12990.03 Da Isoelectric Point: 5.7234
>T282920 WP_003179128.1 NZ_CP126496:1261979-1262329 [Bacillus paralicheniformis]
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNNIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMEKVNEALQISLALIDF
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNNIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMEKVNEALQISLALIDF
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A6I7FHI4 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | M5PDU2 |