Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | /SpoIISA(toxin) |
| Location | 2328237..2329215 | Replicon | chromosome |
| Accession | NZ_CP126474 | ||
| Organism | Bacillus thuringiensis strain DHC4 | ||
Toxin (Protein)
| Gene name | spoIISA | Uniprot ID | W8Y388 |
| Locus tag | QOM09_RS12125 | Protein ID | WP_000624977.1 |
| Coordinates | 2328237..2328974 (+) | Length | 246 a.a. |
Antitoxin (Protein)
| Gene name | - | Uniprot ID | W8YZL5 |
| Locus tag | QOM09_RS12130 | Protein ID | WP_000237818.1 |
| Coordinates | 2329087..2329215 (+) | Length | 43 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QOM09_RS12105 (QOM09_12105) | 2323880..2324662 | + | 783 | WP_000381800.1 | class I SAM-dependent methyltransferase | - |
| QOM09_RS12110 (QOM09_12110) | 2324820..2326505 | - | 1686 | WP_058839616.1 | alpha-keto acid decarboxylase family protein | - |
| QOM09_RS12115 (QOM09_12115) | 2326613..2327095 | + | 483 | WP_000191888.1 | MarR family winged helix-turn-helix transcriptional regulator | - |
| QOM09_RS12120 (QOM09_12120) | 2327262..2327999 | + | 738 | WP_000594152.1 | 2,3-diphosphoglycerate-dependent phosphoglycerate mutase | - |
| QOM09_RS12125 (QOM09_12125) | 2328237..2328974 | + | 738 | WP_000624977.1 | type II toxin-antitoxin system SpoIISA family toxin | Toxin |
| QOM09_RS12130 (QOM09_12130) | 2329087..2329215 | + | 129 | WP_000237818.1 | hypothetical protein | Antitoxin |
| QOM09_RS12135 (QOM09_12135) | 2329288..2329464 | + | 177 | WP_000852629.1 | stage II sporulation protein SB | - |
| QOM09_RS12140 (QOM09_12140) | 2329483..2329872 | - | 390 | WP_000713866.1 | YxeA family protein | - |
| QOM09_RS12145 (QOM09_12145) | 2330084..2331556 | + | 1473 | WP_053513522.1 | beta-Ala-His dipeptidase | - |
| QOM09_RS12150 (QOM09_12150) | 2331799..2332608 | + | 810 | WP_000678509.1 | papain-like cysteine protease family protein | - |
| QOM09_RS12155 (QOM09_12155) | 2332634..2333236 | + | 603 | WP_053513524.1 | hypothetical protein | - |
| QOM09_RS12160 (QOM09_12160) | 2333477..2333728 | - | 252 | WP_000827560.1 | LuxR C-terminal-related transcriptional regulator | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 246 a.a. Molecular weight: 28307.03 Da Isoelectric Point: 8.2998
>T282919 WP_000624977.1 NZ_CP126474:2328237-2328974 [Bacillus thuringiensis]
MISNIRIGLFVLAIVFVVLVFFYWKNEELYEEKKQRIRKTWYGLFIISVTVYFMIKGIDLTLWKNLLMFTAMVIFVDIAF
ILTPNISEIWGAKFSDIGKTVQSIKRSLIASKARGEIYTTIIQNVNPAVFGTMEWHTEEEYTKSLNAFLDSYGEKIGAKI
VVFEAAKELNTNFRGIRSQFSIIVPLEHIEQLNEQKAVQVENVGIIPAKIVSDVFIVIDGKKNNLQDRDFENVYNLTIHH
SYFSK
MISNIRIGLFVLAIVFVVLVFFYWKNEELYEEKKQRIRKTWYGLFIISVTVYFMIKGIDLTLWKNLLMFTAMVIFVDIAF
ILTPNISEIWGAKFSDIGKTVQSIKRSLIASKARGEIYTTIIQNVNPAVFGTMEWHTEEEYTKSLNAFLDSYGEKIGAKI
VVFEAAKELNTNFRGIRSQFSIIVPLEHIEQLNEQKAVQVENVGIIPAKIVSDVFIVIDGKKNNLQDRDFENVYNLTIHH
SYFSK
Download Length: 738 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|