Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | pemIK/MazF(toxin) |
Location | 232580..233222 | Replicon | chromosome |
Accession | NZ_CP126474 | ||
Organism | Bacillus thuringiensis strain DHC4 |
Toxin (Protein)
Gene name | pemK | Uniprot ID | R8I8B8 |
Locus tag | QOM09_RS01330 | Protein ID | WP_000635965.1 |
Coordinates | 232872..233222 (+) | Length | 117 a.a. |
Antitoxin (Protein)
Gene name | pemI | Uniprot ID | R8I8H2 |
Locus tag | QOM09_RS01325 | Protein ID | WP_000004570.1 |
Coordinates | 232580..232867 (+) | Length | 96 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QOM09_RS01300 (QOM09_01300) | 227897..228859 | + | 963 | WP_000961161.1 | UV DNA damage repair endonuclease UvsE | - |
QOM09_RS01305 (QOM09_01305) | 228852..229424 | - | 573 | WP_000908523.1 | rhomboid family intramembrane serine protease | - |
QOM09_RS01310 (QOM09_01310) | 229518..229877 | + | 360 | WP_000583417.1 | holo-ACP synthase | - |
QOM09_RS01315 (QOM09_01315) | 230034..230984 | + | 951 | WP_053514347.1 | outer membrane lipoprotein carrier protein LolA | - |
QOM09_RS01320 (QOM09_01320) | 231102..232271 | + | 1170 | WP_053514326.1 | alanine racemase | - |
QOM09_RS01325 (QOM09_01325) | 232580..232867 | + | 288 | WP_000004570.1 | antitoxin EndoAI | Antitoxin |
QOM09_RS01330 (QOM09_01330) | 232872..233222 | + | 351 | WP_000635965.1 | type II toxin-antitoxin system endoribonuclease NdoA | Toxin |
QOM09_RS01335 (QOM09_01335) | 233290..235458 | + | 2169 | WP_000426236.1 | Tex family protein | - |
QOM09_RS01340 (QOM09_01340) | 235516..235632 | - | 117 | WP_001143642.1 | cortex morphogenetic protein CmpA | - |
QOM09_RS01345 (QOM09_01345) | 235828..236286 | + | 459 | WP_000344241.1 | SprT family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12948.04 Da Isoelectric Point: 5.7168
>T282918 WP_000635965.1 NZ_CP126474:232872-233222 [Bacillus thuringiensis]
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTVIVAAITAQIQKAKLPTHVEIDAKKYGFERDSVILLEQI
RTIDKQRLTDKITHLDEVMMSRVDEALQISLGLIDF
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTVIVAAITAQIQKAKLPTHVEIDAKKYGFERDSVILLEQI
RTIDKQRLTDKITHLDEVMMSRVDEALQISLGLIDF
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A366G118 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A366FY90 |