Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | pemIK/MazF(toxin) |
| Location | 241200..241842 | Replicon | chromosome |
| Accession | NZ_CP126463 | ||
| Organism | Bacillus anthracis strain BHY1401 | ||
Toxin (Protein)
| Gene name | pemK | Uniprot ID | J8CWW5 |
| Locus tag | QN296_RS01325 | Protein ID | WP_000635963.1 |
| Coordinates | 241492..241842 (+) | Length | 117 a.a. |
Antitoxin (Protein)
| Gene name | pemI | Uniprot ID | R8I8H2 |
| Locus tag | QN296_RS01320 | Protein ID | WP_000004570.1 |
| Coordinates | 241200..241487 (+) | Length | 96 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QN296_RS01295 (QN296_01295) | 236516..237478 | + | 963 | WP_000961037.1 | UV DNA damage repair endonuclease UvsE | - |
| QN296_RS01300 (QN296_01300) | 237471..238043 | - | 573 | WP_000906916.1 | rhomboid family intramembrane serine protease | - |
| QN296_RS01305 (QN296_01305) | 238136..238495 | + | 360 | WP_000635040.1 | holo-ACP synthase | - |
| QN296_RS01310 (QN296_01310) | 238652..239602 | + | 951 | WP_025388382.1 | outer membrane lipoprotein carrier protein LolA | - |
| QN296_RS01315 (QN296_01315) | 239721..240890 | + | 1170 | WP_000390596.1 | alanine racemase | - |
| QN296_RS01320 (QN296_01320) | 241200..241487 | + | 288 | WP_000004570.1 | antitoxin EndoAI | Antitoxin |
| QN296_RS01325 (QN296_01325) | 241492..241842 | + | 351 | WP_000635963.1 | type II toxin-antitoxin system endoribonuclease NdoA | Toxin |
| QN296_RS01330 (QN296_01330) | 241910..244078 | + | 2169 | WP_000426225.1 | Tex family protein | - |
| QN296_RS01335 (QN296_01335) | 244136..244252 | - | 117 | WP_001143642.1 | cortex morphogenetic protein CmpA | - |
| QN296_RS01340 (QN296_01340) | 244448..244906 | + | 459 | WP_000344248.1 | SprT family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12974.12 Da Isoelectric Point: 5.7168
>T282916 WP_000635963.1 NZ_CP126463:241492-241842 [Bacillus anthracis]
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTVIVAAITAQIQKAKLPTHVEIDAKKYGFERDSVILLEQI
RTIDKQRLTDKITHLDEVMMIRVDEALQISLGLIDF
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTVIVAAITAQIQKAKLPTHVEIDAKKYGFERDSVILLEQI
RTIDKQRLTDKITHLDEVMMIRVDEALQISLGLIDF
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| PDB | 4HKE | |
| PDB | 7BXY |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A366FY90 |