Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | pemK-mazE/MazF(toxin) |
| Location | 274452..275082 | Replicon | chromosome |
| Accession | NZ_CP126462 | ||
| Organism | Caminicella sporogenes strain HV-G | ||
Toxin (Protein)
| Gene name | pemK | Uniprot ID | - |
| Locus tag | QNI18_RS01400 | Protein ID | WP_284552984.1 |
| Coordinates | 274452..274802 (-) | Length | 117 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | - |
| Locus tag | QNI18_RS01405 | Protein ID | WP_284552985.1 |
| Coordinates | 274804..275082 (-) | Length | 93 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QNI18_RS01380 (QNI18_01380) | 270413..271522 | - | 1110 | WP_284552981.1 | glycosyltransferase | - |
| QNI18_RS01385 (QNI18_01385) | 271550..272074 | - | 525 | WP_072967129.1 | DapH/DapD/GlmU-related protein | - |
| QNI18_RS01390 (QNI18_01390) | 272078..273646 | - | 1569 | WP_284552982.1 | murein biosynthesis integral membrane protein MurJ | - |
| QNI18_RS01395 (QNI18_01395) | 273716..274282 | - | 567 | WP_284552983.1 | hypothetical protein | - |
| QNI18_RS01400 (QNI18_01400) | 274452..274802 | - | 351 | WP_284552984.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| QNI18_RS01405 (QNI18_01405) | 274804..275082 | - | 279 | WP_284552985.1 | ribbon-helix-helix protein, CopG family | Antitoxin |
| QNI18_RS01410 (QNI18_01410) | 275220..276389 | - | 1170 | WP_284552986.1 | alanine racemase | - |
| QNI18_RS01415 (QNI18_01415) | 276408..277037 | - | 630 | WP_284552987.1 | outer-membrane lipoprotein carrier protein LolA | - |
| QNI18_RS01420 (QNI18_01420) | 277119..278666 | - | 1548 | WP_284552988.1 | NAD(P)H-hydrate dehydratase | - |
| QNI18_RS01425 (QNI18_01425) | 278758..279123 | - | 366 | WP_284552989.1 | holo-ACP synthase | - |
| QNI18_RS01430 (QNI18_01430) | 279276..279872 | - | 597 | WP_284552990.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12866.21 Da Isoelectric Point: 9.6003
>T282915 WP_284552984.1 NZ_CP126462:c274802-274452 [Caminicella sporogenes]
MLIKRGDVFYADLSPVIGSEQGGVRPVLVIQNDIGNKYSPTVIIAAITSQINKAKLPTHVELNGLKNGLPKDSVILLEQV
RTIDKRRFIEKICRLDENIMKKVNEALMISLGLVDI
MLIKRGDVFYADLSPVIGSEQGGVRPVLVIQNDIGNKYSPTVIIAAITSQINKAKLPTHVELNGLKNGLPKDSVILLEQV
RTIDKRRFIEKICRLDENIMKKVNEALMISLGLVDI
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|