Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
Location | 2226552..2227188 | Replicon | chromosome |
Accession | NZ_CP126456 | ||
Organism | Bacillus altitudinis strain KRS010 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | K2MHT4 |
Locus tag | QLQ03_RS11350 | Protein ID | WP_003214169.1 |
Coordinates | 2226838..2227188 (+) | Length | 117 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | W8QJ31 |
Locus tag | QLQ03_RS11345 | Protein ID | WP_003214273.1 |
Coordinates | 2226552..2226833 (+) | Length | 94 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QLQ03_RS11325 | 2222706..2223311 | - | 606 | WP_007496491.1 | rhomboid family intramembrane serine protease | - |
QLQ03_RS11330 | 2223406..2223771 | + | 366 | WP_058214404.1 | holo-ACP synthase | - |
QLQ03_RS11335 | 2223932..2224948 | + | 1017 | WP_007496489.1 | outer membrane lipoprotein-sorting protein | - |
QLQ03_RS11340 | 2225077..2226258 | + | 1182 | WP_284564914.1 | alanine racemase | - |
QLQ03_RS11345 | 2226552..2226833 | + | 282 | WP_003214273.1 | hypothetical protein | Antitoxin |
QLQ03_RS11350 | 2226838..2227188 | + | 351 | WP_003214169.1 | type II toxin-antitoxin system endoribonuclease NdoA | Toxin |
QLQ03_RS11355 | 2227305..2228135 | + | 831 | WP_008346908.1 | RsbT co-antagonist protein RsbRA | - |
QLQ03_RS11360 | 2228140..2228508 | + | 369 | WP_003214235.1 | RsbT antagonist protein RsbS | - |
QLQ03_RS11365 | 2228511..2228912 | + | 402 | WP_019744214.1 | anti-sigma regulatory factor | - |
QLQ03_RS11370 | 2228923..2229930 | + | 1008 | WP_008346904.1 | PP2C family protein-serine/threonine phosphatase | - |
QLQ03_RS11375 | 2229990..2230319 | + | 330 | WP_008346902.1 | anti-sigma factor antagonist | - |
QLQ03_RS11380 | 2230316..2230804 | + | 489 | WP_019744216.1 | anti-sigma B factor RsbW | - |
QLQ03_RS11385 | 2230770..2231558 | + | 789 | WP_012009000.1 | RNA polymerase sigma factor SigB | - |
QLQ03_RS11390 | 2231558..2232157 | + | 600 | WP_008346897.1 | PP2C family serine/threonine-protein phosphatase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12976.99 Da Isoelectric Point: 5.1663
>T282914 WP_003214169.1 NZ_CP126456:2226838-2227188 [Bacillus altitudinis]
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEINAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMEKVDEALQVSLALIDF
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEINAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMEKVDEALQVSLALIDF
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | K2MHT4 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A081L854 |