Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/PRK09907-MazE |
Location | 1237655..1238220 | Replicon | chromosome |
Accession | NZ_CP126446 | ||
Organism | Pontibacillus chungwhensis strain HN14 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | - |
Locus tag | QNI29_RS06460 | Protein ID | WP_231418086.1 |
Coordinates | 1237891..1238220 (+) | Length | 110 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | - |
Locus tag | QNI29_RS06455 | Protein ID | WP_231418087.1 |
Coordinates | 1237655..1237891 (+) | Length | 79 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QNI29_RS06430 (QNI29_06430) | 1232730..1233983 | + | 1254 | WP_231418092.1 | aminopeptidase | - |
QNI29_RS06435 (QNI29_06435) | 1234127..1234657 | + | 531 | WP_231418091.1 | GrpB family protein | - |
QNI29_RS06440 (QNI29_06440) | 1235606..1236271 | + | 666 | WP_231418090.1 | Type 1 glutamine amidotransferase-like domain-containing protein | - |
QNI29_RS06445 (QNI29_06445) | 1236297..1236737 | + | 441 | WP_231418089.1 | GNAT family N-acetyltransferase | - |
QNI29_RS06450 (QNI29_06450) | 1236874..1237491 | + | 618 | WP_231418088.1 | hypothetical protein | - |
QNI29_RS06455 (QNI29_06455) | 1237655..1237891 | + | 237 | WP_231418087.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
QNI29_RS06460 (QNI29_06460) | 1237891..1238220 | + | 330 | WP_231418086.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
QNI29_RS06465 (QNI29_06465) | 1238784..1239959 | + | 1176 | WP_231418085.1 | MFS transporter | - |
QNI29_RS06470 (QNI29_06470) | 1240204..1240662 | + | 459 | WP_231418084.1 | hypothetical protein | - |
QNI29_RS06475 (QNI29_06475) | 1241023..1241427 | + | 405 | WP_231418083.1 | hypothetical protein | - |
QNI29_RS06480 (QNI29_06480) | 1241465..1241869 | + | 405 | WP_231418082.1 | ester cyclase | - |
QNI29_RS06485 (QNI29_06485) | 1241923..1242612 | + | 690 | WP_231418081.1 | DNA alkylation repair protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 110 a.a. Molecular weight: 12138.99 Da Isoelectric Point: 9.1934
>T282913 WP_231418086.1 NZ_CP126446:1237891-1238220 [Pontibacillus chungwhensis]
VNAPKRGDLVYLTFDPQAGHEQRGRRPGIVLSPQPFNNKTGFALCCPITNQQKGYPFEVSLPVNRKISGVILTDQIKSLD
WKARKISLVDEAPNSVVQSCLELVKTYLD
VNAPKRGDLVYLTFDPQAGHEQRGRRPGIVLSPQPFNNKTGFALCCPITNQQKGYPFEVSLPVNRKISGVILTDQIKSLD
WKARKISLVDEAPNSVVQSCLELVKTYLD
Download Length: 330 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|