Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | pemIK/MazF(toxin) |
Location | 259074..259710 | Replicon | chromosome |
Accession | NZ_CP126446 | ||
Organism | Pontibacillus chungwhensis strain HN14 |
Toxin (Protein)
Gene name | pemK | Uniprot ID | A0A0A2UP65 |
Locus tag | QNI29_RS01465 | Protein ID | WP_036786621.1 |
Coordinates | 259360..259710 (+) | Length | 117 a.a. |
Antitoxin (Protein)
Gene name | pemI | Uniprot ID | - |
Locus tag | QNI29_RS01460 | Protein ID | WP_284526990.1 |
Coordinates | 259074..259355 (+) | Length | 94 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QNI29_RS01440 (QNI29_01440) | 254570..254926 | + | 357 | WP_231419644.1 | holo-ACP synthase | - |
QNI29_RS01445 (QNI29_01445) | 255001..256515 | + | 1515 | WP_231419645.1 | NAD(P)H-hydrate dehydratase | - |
QNI29_RS01450 (QNI29_01450) | 256570..257595 | + | 1026 | WP_231419646.1 | outer membrane lipoprotein carrier protein LolA | - |
QNI29_RS01455 (QNI29_01455) | 257745..258917 | + | 1173 | WP_231419647.1 | alanine racemase | - |
QNI29_RS01460 (QNI29_01460) | 259074..259355 | + | 282 | WP_284526990.1 | antitoxin | Antitoxin |
QNI29_RS01465 (QNI29_01465) | 259360..259710 | + | 351 | WP_036786621.1 | type II toxin-antitoxin system endoribonuclease NdoA | Toxin |
QNI29_RS01470 (QNI29_01470) | 259943..260812 | + | 870 | WP_231419649.1 | RsbT co-antagonist protein RsbRA | - |
QNI29_RS01475 (QNI29_01475) | 260818..261174 | + | 357 | WP_255688851.1 | STAS domain-containing protein | - |
QNI29_RS01480 (QNI29_01480) | 261179..261580 | + | 402 | WP_036786615.1 | anti-sigma regulatory factor | - |
QNI29_RS01485 (QNI29_01485) | 261595..262605 | + | 1011 | WP_231419650.1 | PP2C family protein-serine/threonine phosphatase | - |
QNI29_RS01490 (QNI29_01490) | 262671..263006 | + | 336 | WP_231419651.1 | STAS domain-containing protein | - |
QNI29_RS01495 (QNI29_01495) | 263006..263485 | + | 480 | WP_231419652.1 | anti-sigma B factor RsbW | - |
QNI29_RS01500 (QNI29_01500) | 263457..264248 | + | 792 | WP_231419653.1 | RNA polymerase sigma factor SigB | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12962.97 Da Isoelectric Point: 4.8668
>T282912 WP_036786621.1 NZ_CP126446:259360-259710 [Pontibacillus chungwhensis]
MIVKRGDVYFADLSPVVGSEQGGVRPVLILQNDIGNRFSPTVIVAAITAQIQKAKLPTHVEIDAERYGFERDSVILLEQI
RTIDKQRLTDKITHLDEAMMSRVDEALQISLGLIDF
MIVKRGDVYFADLSPVVGSEQGGVRPVLILQNDIGNRFSPTVIVAAITAQIQKAKLPTHVEIDAERYGFERDSVILLEQI
RTIDKQRLTDKITHLDEAMMSRVDEALQISLGLIDF
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|