Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) ykfI-yfjZ/CbtA-CbeA
Location 3966163..3966842 Replicon chromosome
Accession NZ_CP126348
Organism Escherichia coli strain NN5

Toxin (Protein)


Gene name ykfI Uniprot ID -
Locus tag QN227_RS18950 Protein ID WP_033557155.1
Coordinates 3966163..3966504 (-) Length 114 a.a.

Antitoxin (Protein)


Gene name yfjZ Uniprot ID -
Locus tag QN227_RS18955 Protein ID WP_033557156.1
Coordinates 3966525..3966842 (-) Length 106 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QN227_RS18925 (3961373) 3961373..3961477 - 105 Protein_3698 HNH endonuclease -
QN227_RS18930 (3961577) 3961577..3962449 + 873 WP_033557147.1 HNH endonuclease -
QN227_RS18935 (3962560) 3962560..3963558 - 999 WP_033557146.1 membrane protein -
QN227_RS18940 (3964165) 3964165..3964671 + 507 WP_050516361.1 hypothetical protein -
QN227_RS18945 (3964699) 3964699..3965861 + 1163 WP_094081552.1 IS3-like element IS3 family transposase -
QN227_RS18950 (3966163) 3966163..3966504 - 342 WP_033557155.1 TA system toxin CbtA family protein Toxin
QN227_RS18955 (3966525) 3966525..3966842 - 318 WP_033557156.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
QN227_RS18960 (3966897) 3966897..3967030 - 134 Protein_3705 DUF987 family protein -
QN227_RS18965 (3967039) 3967039..3967515 - 477 WP_033557157.1 RadC family protein -
QN227_RS18970 (3967531) 3967531..3967989 - 459 WP_033557158.1 antirestriction protein -
QN227_RS18975 (3968075) 3968075..3968311 - 237 WP_033557159.1 DUF905 domain-containing protein -
QN227_RS18980 (3968389) 3968389..3968799 - 411 WP_033557160.1 hypothetical protein -
QN227_RS18985 (3968866) 3968866..3969303 - 438 WP_033557163.1 hypothetical protein -
QN227_RS18990 (3969345) 3969345..3969881 - 537 WP_033557164.1 DUF4339 domain-containing protein -
QN227_RS18995 (3969907) 3969907..3970617 - 711 WP_033557166.1 DeoR family transcriptional regulator -
QN227_RS19000 (3970826) 3970826..3971650 - 825 WP_033557167.1 DUF932 domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - fimB 3956420..4014105 57685


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-111)

Antitoxin

Antitoxin CbeA

(5-104)


Sequences

Toxin        


Download         Length: 114 a.a.        Molecular weight: 12915.97 Da        Isoelectric Point: 8.9917

>T282907 WP_033557155.1 NZ_CP126348:c3966504-3966163 [Escherichia coli]
MKPQPATTSRAVKPCLSPVAVWQMLLTRLLEQHYGLTLNDTPFSDETVIKEHIDAGITLADAVNFLVEKYELVRIDRRGF
NWQEQSPYLRAVDILRARRAIGLLRRSLNDAVL

Download         Length: 342 bp

Antitoxin


Download         Length: 106 a.a.        Molecular weight: 11920.54 Da        Isoelectric Point: 6.7380

>AT282907 WP_033557156.1 NZ_CP126348:c3966842-3966525 [Escherichia coli]
MSNITWGLQRDITPHLGARLVQEGNRLHYLADRASIIGKFSGAECRKLDEIFPHFISQMESMLTTGELNPRYTHCITLYH
NGFTCEADTLGSCGYVYIAIYPNQH

Download         Length: 318 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References