Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | ykfI-yfjZ/CbtA-CbeA |
| Location | 3966163..3966842 | Replicon | chromosome |
| Accession | NZ_CP126348 | ||
| Organism | Escherichia coli strain NN5 | ||
Toxin (Protein)
| Gene name | ykfI | Uniprot ID | - |
| Locus tag | QN227_RS18950 | Protein ID | WP_033557155.1 |
| Coordinates | 3966163..3966504 (-) | Length | 114 a.a. |
Antitoxin (Protein)
| Gene name | yfjZ | Uniprot ID | - |
| Locus tag | QN227_RS18955 | Protein ID | WP_033557156.1 |
| Coordinates | 3966525..3966842 (-) | Length | 106 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QN227_RS18925 (3961373) | 3961373..3961477 | - | 105 | Protein_3698 | HNH endonuclease | - |
| QN227_RS18930 (3961577) | 3961577..3962449 | + | 873 | WP_033557147.1 | HNH endonuclease | - |
| QN227_RS18935 (3962560) | 3962560..3963558 | - | 999 | WP_033557146.1 | membrane protein | - |
| QN227_RS18940 (3964165) | 3964165..3964671 | + | 507 | WP_050516361.1 | hypothetical protein | - |
| QN227_RS18945 (3964699) | 3964699..3965861 | + | 1163 | WP_094081552.1 | IS3-like element IS3 family transposase | - |
| QN227_RS18950 (3966163) | 3966163..3966504 | - | 342 | WP_033557155.1 | TA system toxin CbtA family protein | Toxin |
| QN227_RS18955 (3966525) | 3966525..3966842 | - | 318 | WP_033557156.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| QN227_RS18960 (3966897) | 3966897..3967030 | - | 134 | Protein_3705 | DUF987 family protein | - |
| QN227_RS18965 (3967039) | 3967039..3967515 | - | 477 | WP_033557157.1 | RadC family protein | - |
| QN227_RS18970 (3967531) | 3967531..3967989 | - | 459 | WP_033557158.1 | antirestriction protein | - |
| QN227_RS18975 (3968075) | 3968075..3968311 | - | 237 | WP_033557159.1 | DUF905 domain-containing protein | - |
| QN227_RS18980 (3968389) | 3968389..3968799 | - | 411 | WP_033557160.1 | hypothetical protein | - |
| QN227_RS18985 (3968866) | 3968866..3969303 | - | 438 | WP_033557163.1 | hypothetical protein | - |
| QN227_RS18990 (3969345) | 3969345..3969881 | - | 537 | WP_033557164.1 | DUF4339 domain-containing protein | - |
| QN227_RS18995 (3969907) | 3969907..3970617 | - | 711 | WP_033557166.1 | DeoR family transcriptional regulator | - |
| QN227_RS19000 (3970826) | 3970826..3971650 | - | 825 | WP_033557167.1 | DUF932 domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | fimB | 3956420..4014105 | 57685 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 12915.97 Da Isoelectric Point: 8.9917
>T282907 WP_033557155.1 NZ_CP126348:c3966504-3966163 [Escherichia coli]
MKPQPATTSRAVKPCLSPVAVWQMLLTRLLEQHYGLTLNDTPFSDETVIKEHIDAGITLADAVNFLVEKYELVRIDRRGF
NWQEQSPYLRAVDILRARRAIGLLRRSLNDAVL
MKPQPATTSRAVKPCLSPVAVWQMLLTRLLEQHYGLTLNDTPFSDETVIKEHIDAGITLADAVNFLVEKYELVRIDRRGF
NWQEQSPYLRAVDILRARRAIGLLRRSLNDAVL
Download Length: 342 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|