Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | itaRT/DUF1778(antitoxin) |
Location | 3390766..3391603 | Replicon | chromosome |
Accession | NZ_CP126348 | ||
Organism | Escherichia coli strain NN5 |
Toxin (Protein)
Gene name | itaT | Uniprot ID | Q3Z4X7 |
Locus tag | QN227_RS16275 | Protein ID | WP_000227784.1 |
Coordinates | 3391061..3391603 (+) | Length | 181 a.a. |
Antitoxin (Protein)
Gene name | itaR | Uniprot ID | I2UQS9 |
Locus tag | QN227_RS16270 | Protein ID | WP_001297137.1 |
Coordinates | 3390766..3391077 (+) | Length | 104 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QN227_RS16245 (3385786) | 3385786..3386733 | + | 948 | WP_001239441.1 | cytochrome o ubiquinol oxidase subunit II | - |
QN227_RS16250 (3386755) | 3386755..3388746 | + | 1992 | WP_000467180.1 | cytochrome o ubiquinol oxidase subunit I | - |
QN227_RS16255 (3388736) | 3388736..3389350 | + | 615 | WP_000179819.1 | cytochrome o ubiquinol oxidase subunit III | - |
QN227_RS16260 (3389350) | 3389350..3389679 | + | 330 | WP_000019869.1 | cytochrome o ubiquinol oxidase subunit IV | - |
QN227_RS16265 (3389691) | 3389691..3390581 | + | 891 | WP_000971336.1 | heme o synthase | - |
QN227_RS16270 (3390766) | 3390766..3391077 | + | 312 | WP_001297137.1 | DUF1778 domain-containing protein | Antitoxin |
QN227_RS16275 (3391061) | 3391061..3391603 | + | 543 | WP_000227784.1 | GNAT family N-acetyltransferase | Toxin |
QN227_RS16280 (3391659) | 3391659..3392594 | - | 936 | WP_001297127.1 | tetratricopeptide repeat protein | - |
QN227_RS16285 (3393002) | 3393002..3394366 | + | 1365 | WP_001000975.1 | MFS transporter | - |
QN227_RS16290 (3394494) | 3394494..3394985 | - | 492 | WP_001138904.1 | nucleotide binding protein YajQ | - |
QN227_RS16295 (3395153) | 3395153..3396064 | + | 912 | WP_284556540.1 | 2-dehydropantoate 2-reductase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 181 a.a. Molecular weight: 19805.02 Da Isoelectric Point: 8.3395
>T282905 WP_000227784.1 NZ_CP126348:3391061-3391603 [Escherichia coli]
MVDKHEEITLPIVLSCNYQSDITYPGQKQFDCGNPVIDKFVRASLKKSVRNSDCAAKALIDRQSGELIGICTFTAYSLEK
QRVSGVLQGSQPSEIGVVRLVMLGVARKYQKRGFGQDLLCDFFEHVKIIHQALPIKGVYLDADPAAINFYARLGFVQLSA
TPNAFGAVPMFLAIQHILAA
MVDKHEEITLPIVLSCNYQSDITYPGQKQFDCGNPVIDKFVRASLKKSVRNSDCAAKALIDRQSGELIGICTFTAYSLEK
QRVSGVLQGSQPSEIGVVRLVMLGVARKYQKRGFGQDLLCDFFEHVKIIHQALPIKGVYLDADPAAINFYARLGFVQLSA
TPNAFGAVPMFLAIQHILAA
Download Length: 543 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|