Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VagC |
Location | 1320323..1320948 | Replicon | chromosome |
Accession | NZ_CP126348 | ||
Organism | Escherichia coli strain NN5 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | QN227_RS06390 | Protein ID | WP_000911330.1 |
Coordinates | 1320550..1320948 (+) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | U9XQV3 |
Locus tag | QN227_RS06385 | Protein ID | WP_000450524.1 |
Coordinates | 1320323..1320550 (+) | Length | 76 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QN227_RS06360 (1316126) | 1316126..1316596 | - | 471 | WP_001068682.1 | thioredoxin-dependent thiol peroxidase | - |
QN227_RS06365 (1316596) | 1316596..1317168 | - | 573 | WP_000176187.1 | glycine cleavage system transcriptional repressor | - |
QN227_RS06370 (1317314) | 1317314..1318192 | + | 879 | WP_001295469.1 | 4-hydroxy-tetrahydrodipicolinate synthase | - |
QN227_RS06375 (1318209) | 1318209..1319243 | + | 1035 | WP_033557475.1 | outer membrane protein assembly factor BamC | - |
QN227_RS06380 (1319456) | 1319456..1320169 | + | 714 | WP_033557474.1 | phosphoribosylaminoimidazolesuccinocarboxamide synthase | - |
QN227_RS06385 (1320323) | 1320323..1320550 | + | 228 | WP_000450524.1 | toxin-antitoxin system antitoxin VapB | Antitoxin |
QN227_RS06390 (1320550) | 1320550..1320948 | + | 399 | WP_000911330.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
QN227_RS06395 (1321095) | 1321095..1321958 | + | 864 | WP_001267508.1 | neutral zinc metallopeptidase | - |
QN227_RS06400 (1321973) | 1321973..1323988 | + | 2016 | WP_033557473.1 | tRNA cytosine(34) acetyltransferase TmcA | - |
QN227_RS06405 (1324062) | 1324062..1324760 | + | 699 | WP_000679812.1 | esterase | - |
QN227_RS06410 (1324870) | 1324870..1325070 | - | 201 | WP_000383836.1 | YpfN family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 14894.25 Da Isoelectric Point: 9.2216
>T282897 WP_000911330.1 NZ_CP126348:1320550-1320948 [Escherichia coli]
MLKFMLDTNICIFTIKNKPVHVRERFNLNSGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRLVVLDYDSAAATHT
GQIRAELARQGRPVGPFDQMIAGHARSRGLIVVTNNTREFERVAGIRLEDWS
MLKFMLDTNICIFTIKNKPVHVRERFNLNSGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRLVVLDYDSAAATHT
GQIRAELARQGRPVGPFDQMIAGHARSRGLIVVTNNTREFERVAGIRLEDWS
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|