Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 863691..864345 | Replicon | chromosome |
Accession | NZ_CP126348 | ||
Organism | Escherichia coli strain NN5 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | S1EEB2 |
Locus tag | QN227_RS04225 | Protein ID | WP_000244777.1 |
Coordinates | 863938..864345 (+) | Length | 136 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | S1PPB1 |
Locus tag | QN227_RS04220 | Protein ID | WP_000354046.1 |
Coordinates | 863691..863957 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QN227_RS04195 (858860) | 858860..859603 | + | 744 | WP_033557373.1 | SDR family oxidoreductase | - |
QN227_RS04200 (859660) | 859660..861093 | - | 1434 | WP_001363803.1 | 6-phospho-beta-glucosidase BglA | - |
QN227_RS04205 (861138) | 861138..861449 | + | 312 | WP_001182954.1 | N(4)-acetylcytidine aminohydrolase | - |
QN227_RS04210 (861613) | 861613..862272 | + | 660 | WP_033557372.1 | hemolysin III family protein | - |
QN227_RS04215 (862468) | 862468..863448 | - | 981 | WP_000886062.1 | tRNA-modifying protein YgfZ | - |
QN227_RS04220 (863691) | 863691..863957 | + | 267 | WP_000354046.1 | FAD assembly factor SdhE | Antitoxin |
QN227_RS04225 (863938) | 863938..864345 | + | 408 | WP_000244777.1 | protein YgfX | Toxin |
QN227_RS04230 (864385) | 864385..864906 | - | 522 | WP_001055874.1 | flavodoxin FldB | - |
QN227_RS04235 (865018) | 865018..865914 | + | 897 | WP_000806638.1 | site-specific tyrosine recombinase XerD | - |
QN227_RS04240 (865939) | 865939..866649 | + | 711 | WP_000715214.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
QN227_RS04245 (866655) | 866655..868388 | + | 1734 | WP_033557371.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 16031.96 Da Isoelectric Point: 11.5202
>T282894 WP_000244777.1 NZ_CP126348:863938-864345 [Escherichia coli]
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDGGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDGGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U9LFV7 |
Antitoxin
Source | ID | Structure |
---|---|---|
PDB | 6B58 | |
PDB | 1X6I | |
PDB | 1X6J | |
PDB | 6C12 | |
AlphaFold DB | A0A7U9QD57 |