Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/ParE-DnaT
Location 22751..23273 Replicon plasmid pDX6B
Accession NZ_CP126347
Organism Escherichia coli strain DX6

Toxin (Protein)


Gene name relE Uniprot ID G3CAN5
Locus tag QN223_RS24240 Protein ID WP_000220560.1
Coordinates 22992..23273 (+) Length 94 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID G3CAG1
Locus tag QN223_RS24235 Protein ID WP_000121743.1
Coordinates 22751..23002 (+) Length 84 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QN223_RS24205 (QN223_24205) 18114..18344 + 231 WP_000051064.1 plasmid partition protein ParG -
QN223_RS24210 (QN223_24210) 18360..18653 + 294 WP_015060510.1 hypothetical protein -
QN223_RS24215 (QN223_24215) 18655..19623 + 969 WP_077249520.1 IS5-like element IS903B family transposase -
QN223_RS24220 (QN223_24220) 19683..20036 - 354 WP_000876434.1 DNA distortion polypeptide 3 -
QN223_RS24225 (QN223_24225) 20173..20619 - 447 WP_001074386.1 hypothetical protein -
QN223_RS24230 (QN223_24230) 20659..21495 - 837 WP_001050931.1 RepB family plasmid replication initiator protein -
QN223_RS24235 (QN223_24235) 22751..23002 + 252 WP_000121743.1 plasmid stabilization protein Antitoxin
QN223_RS24240 (QN223_24240) 22992..23273 + 282 WP_000220560.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
QN223_RS24245 (QN223_24245) 23419..23742 + 324 WP_001181903.1 hypothetical protein -
QN223_RS24250 (QN223_24250) 23787..24032 + 246 WP_000356546.1 hypothetical protein -
QN223_RS24255 (QN223_24255) 24022..24237 + 216 WP_001180116.1 hypothetical protein -
QN223_RS24260 (QN223_24260) 24330..24659 + 330 WP_000866648.1 hypothetical protein -
QN223_RS24265 (QN223_24265) 24946..25095 + 150 WP_000003880.1 hypothetical protein -
QN223_RS24270 (QN223_24270) 25108..25380 + 273 WP_000160399.1 hypothetical protein -
QN223_RS24275 (QN223_24275) 25707..26252 + 546 WP_038976855.1 DNA distortion polypeptide 1 -
QN223_RS24280 (QN223_24280) 26255..27412 + 1158 WP_284564358.1 DNA distortion polypeptide 2 -
QN223_RS24285 (QN223_24285) 27773..28264 + 492 WP_000872475.1 transcription termination/antitermination NusG family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid blaOXA-10 / cmlA1 / ARR-3 / qnrS1 / tet(A) / aph(3')-Ia / blaCTX-M-55 / dfrA14 - 1..53346 53346
- inside Integron dfrA14 / cmlA1 / blaOXA-10 / ant(3'')-Ia / aadA8b / ARR-2 - 1..53346 53345


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(5-86)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 94 a.a.        Molecular weight: 11005.83 Da        Isoelectric Point: 10.5938

>T282891 WP_000220560.1 NZ_CP126347:22992-23273 [Escherichia coli]
MTYELAFDRRALKEWQKLGHTIREQFKKKLAERLENPRVPAARLHGHADRYKIKLRASGYRLVYQVIDEKVVLLVIAVGR
RESSEVYQIADLR

Download         Length: 282 bp

Antitoxin


Download         Length: 84 a.a.        Molecular weight: 9194.43 Da        Isoelectric Point: 4.1683

>AT282891 WP_000121743.1 NZ_CP126347:22751-23002 [Escherichia coli]
MSYQILTTTAASITDLKKNPMGTVAEGEGDAVAILNRNEPAFYCVPPKLYAYYRELAEDAELNAVADERMKNPEIVKVNL
DDL

Download         Length: 252 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB G3CAN5

Antitoxin

Source ID Structure
AlphaFold DB A0A3S5I301

References