Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | itaRT/DUF1778(antitoxin) |
Location | 3539008..3539845 | Replicon | chromosome |
Accession | NZ_CP126345 | ||
Organism | Escherichia coli strain DX6 |
Toxin (Protein)
Gene name | itaT | Uniprot ID | Q3Z4X7 |
Locus tag | QN223_RS17375 | Protein ID | WP_000227784.1 |
Coordinates | 3539303..3539845 (+) | Length | 181 a.a. |
Antitoxin (Protein)
Gene name | itaR | Uniprot ID | I2UQS9 |
Locus tag | QN223_RS17370 | Protein ID | WP_001297137.1 |
Coordinates | 3539008..3539319 (+) | Length | 104 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QN223_RS17345 (3534028) | 3534028..3534975 | + | 948 | WP_001239441.1 | cytochrome o ubiquinol oxidase subunit II | - |
QN223_RS17350 (3534997) | 3534997..3536988 | + | 1992 | WP_000467180.1 | cytochrome o ubiquinol oxidase subunit I | - |
QN223_RS17355 (3536978) | 3536978..3537592 | + | 615 | WP_000179819.1 | cytochrome o ubiquinol oxidase subunit III | - |
QN223_RS17360 (3537592) | 3537592..3537921 | + | 330 | WP_000019869.1 | cytochrome o ubiquinol oxidase subunit IV | - |
QN223_RS17365 (3537933) | 3537933..3538823 | + | 891 | WP_000971336.1 | heme o synthase | - |
QN223_RS17370 (3539008) | 3539008..3539319 | + | 312 | WP_001297137.1 | DUF1778 domain-containing protein | Antitoxin |
QN223_RS17375 (3539303) | 3539303..3539845 | + | 543 | WP_000227784.1 | GNAT family N-acetyltransferase | Toxin |
QN223_RS17380 (3539901) | 3539901..3540836 | - | 936 | WP_001297127.1 | tetratricopeptide repeat protein | - |
QN223_RS17385 (3541244) | 3541244..3542608 | + | 1365 | WP_001000978.1 | MFS transporter | - |
QN223_RS17390 (3542736) | 3542736..3543227 | - | 492 | WP_001138904.1 | nucleotide binding protein YajQ | - |
QN223_RS17395 (3543395) | 3543395..3544306 | + | 912 | WP_000705847.1 | 2-dehydropantoate 2-reductase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 181 a.a. Molecular weight: 19805.02 Da Isoelectric Point: 8.3395
>T282885 WP_000227784.1 NZ_CP126345:3539303-3539845 [Escherichia coli]
MVDKHEEITLPIVLSCNYQSDITYPGQKQFDCGNPVIDKFVRASLKKSVRNSDCAAKALIDRQSGELIGICTFTAYSLEK
QRVSGVLQGSQPSEIGVVRLVMLGVARKYQKRGFGQDLLCDFFEHVKIIHQALPIKGVYLDADPAAINFYARLGFVQLSA
TPNAFGAVPMFLAIQHILAA
MVDKHEEITLPIVLSCNYQSDITYPGQKQFDCGNPVIDKFVRASLKKSVRNSDCAAKALIDRQSGELIGICTFTAYSLEK
QRVSGVLQGSQPSEIGVVRLVMLGVARKYQKRGFGQDLLCDFFEHVKIIHQALPIKGVYLDADPAAINFYARLGFVQLSA
TPNAFGAVPMFLAIQHILAA
Download Length: 543 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|