Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 1892524..1893355 | Replicon | chromosome |
| Accession | NZ_CP126345 | ||
| Organism | Escherichia coli strain DX6 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | - |
| Locus tag | QN223_RS09220 | Protein ID | WP_284564324.1 |
| Coordinates | 1892524..1892898 (-) | Length | 125 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | - |
| Locus tag | QN223_RS09225 | Protein ID | WP_032296135.1 |
| Coordinates | 1892987..1893355 (-) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QN223_RS09180 (1887920) | 1887920..1889086 | + | 1167 | WP_001296209.1 | serine-type D-Ala-D-Ala carboxypeptidase DacD | - |
| QN223_RS09185 (1889205) | 1889205..1889678 | + | 474 | WP_061353310.1 | DNA gyrase inhibitor SbmC | - |
| QN223_RS09190 (1889876) | 1889876..1890934 | + | 1059 | WP_001200890.1 | FUSC family protein | - |
| QN223_RS09195 (1891106) | 1891106..1891435 | + | 330 | WP_000450409.1 | DUF496 family protein | - |
| QN223_RS09200 (1891536) | 1891536..1891670 | - | 135 | WP_001297944.1 | EutP/PduV family microcompartment system protein | - |
| QN223_RS09205 (1891772) | 1891772..1891918 | + | 147 | Protein_1803 | transposase domain-containing protein | - |
| QN223_RS09210 (1892207) | 1892207..1892287 | - | 81 | Protein_1804 | hypothetical protein | - |
| QN223_RS09215 (1892333) | 1892333..1892527 | - | 195 | WP_000988601.1 | DUF5983 family protein | - |
| QN223_RS09220 (1892524) | 1892524..1892898 | - | 375 | WP_284564324.1 | type IV toxin-antitoxin system cytoskeleton-binding toxin CbtA | Toxin |
| QN223_RS09225 (1892987) | 1892987..1893355 | - | 369 | WP_032296135.1 | type IV toxin-antitoxin system cytoskeleton bundling-enhancing antitoxin CbeA | Antitoxin |
| QN223_RS09230 (1893429) | 1893429..1893650 | - | 222 | WP_000692344.1 | DUF987 domain-containing protein | - |
| QN223_RS09235 (1893719) | 1893719..1894195 | - | 477 | WP_001186727.1 | RadC family protein | - |
| QN223_RS09240 (1894211) | 1894211..1894684 | - | 474 | WP_040062104.1 | antirestriction protein | - |
| QN223_RS09245 (1894947) | 1894947..1895768 | - | 822 | WP_001234571.1 | DUF932 domain-containing protein | - |
| QN223_RS09250 (1895989) | 1895989..1896399 | - | 411 | WP_000846704.1 | hypothetical protein | - |
| QN223_RS09255 (1896415) | 1896415..1897092 | - | 678 | WP_284564325.1 | hypothetical protein | - |
| QN223_RS09260 (1897228) | 1897228..1898298 | - | 1071 | WP_058101029.1 | patatin-like phospholipase family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 125 a.a. Molecular weight: 13914.98 Da Isoelectric Point: 7.8522
>T282876 WP_284564324.1 NZ_CP126345:c1892898-1892524 [Escherichia coli]
MKTLPVLPGQAASSRPSPVEIWQILLSRLLDQHYGLTLNDTLFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKYPEAK
MKTLPVLPGQAASSRPSPVEIWQILLSRLLDQHYGLTLNDTLFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKYPEAK
Download Length: 375 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13465.22 Da Isoelectric Point: 5.0468
>AT282876 WP_032296135.1 NZ_CP126345:c1893355-1892987 [Escherichia coli]
VSDTLPGTTLPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGLSSDADAYHPDQAFPLLMKQLELMLTSG
ELNPRNQHTVTLYAKGLACEADTLSSCGYVYLAVYPTPEMKN
VSDTLPGTTLPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGLSSDADAYHPDQAFPLLMKQLELMLTSG
ELNPRNQHTVTLYAKGLACEADTLSSCGYVYLAVYPTPEMKN
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|