Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 1892524..1893355 Replicon chromosome
Accession NZ_CP126345
Organism Escherichia coli strain DX6

Toxin (Protein)


Gene name yeeV Uniprot ID -
Locus tag QN223_RS09220 Protein ID WP_284564324.1
Coordinates 1892524..1892898 (-) Length 125 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID -
Locus tag QN223_RS09225 Protein ID WP_032296135.1
Coordinates 1892987..1893355 (-) Length 123 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QN223_RS09180 (1887920) 1887920..1889086 + 1167 WP_001296209.1 serine-type D-Ala-D-Ala carboxypeptidase DacD -
QN223_RS09185 (1889205) 1889205..1889678 + 474 WP_061353310.1 DNA gyrase inhibitor SbmC -
QN223_RS09190 (1889876) 1889876..1890934 + 1059 WP_001200890.1 FUSC family protein -
QN223_RS09195 (1891106) 1891106..1891435 + 330 WP_000450409.1 DUF496 family protein -
QN223_RS09200 (1891536) 1891536..1891670 - 135 WP_001297944.1 EutP/PduV family microcompartment system protein -
QN223_RS09205 (1891772) 1891772..1891918 + 147 Protein_1803 transposase domain-containing protein -
QN223_RS09210 (1892207) 1892207..1892287 - 81 Protein_1804 hypothetical protein -
QN223_RS09215 (1892333) 1892333..1892527 - 195 WP_000988601.1 DUF5983 family protein -
QN223_RS09220 (1892524) 1892524..1892898 - 375 WP_284564324.1 type IV toxin-antitoxin system cytoskeleton-binding toxin CbtA Toxin
QN223_RS09225 (1892987) 1892987..1893355 - 369 WP_032296135.1 type IV toxin-antitoxin system cytoskeleton bundling-enhancing antitoxin CbeA Antitoxin
QN223_RS09230 (1893429) 1893429..1893650 - 222 WP_000692344.1 DUF987 domain-containing protein -
QN223_RS09235 (1893719) 1893719..1894195 - 477 WP_001186727.1 RadC family protein -
QN223_RS09240 (1894211) 1894211..1894684 - 474 WP_040062104.1 antirestriction protein -
QN223_RS09245 (1894947) 1894947..1895768 - 822 WP_001234571.1 DUF932 domain-containing protein -
QN223_RS09250 (1895989) 1895989..1896399 - 411 WP_000846704.1 hypothetical protein -
QN223_RS09255 (1896415) 1896415..1897092 - 678 WP_284564325.1 hypothetical protein -
QN223_RS09260 (1897228) 1897228..1898298 - 1071 WP_058101029.1 patatin-like phospholipase family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(18-117)


Sequences

Toxin        


Download         Length: 125 a.a.        Molecular weight: 13914.98 Da        Isoelectric Point: 7.8522

>T282876 WP_284564324.1 NZ_CP126345:c1892898-1892524 [Escherichia coli]
MKTLPVLPGQAASSRPSPVEIWQILLSRLLDQHYGLTLNDTLFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKYPEAK

Download         Length: 375 bp

Antitoxin


Download         Length: 123 a.a.        Molecular weight: 13465.22 Da        Isoelectric Point: 5.0468

>AT282876 WP_032296135.1 NZ_CP126345:c1893355-1892987 [Escherichia coli]
VSDTLPGTTLPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGLSSDADAYHPDQAFPLLMKQLELMLTSG
ELNPRNQHTVTLYAKGLACEADTLSSCGYVYLAVYPTPEMKN

Download         Length: 369 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References