Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VagC |
Location | 1404032..1404657 | Replicon | chromosome |
Accession | NZ_CP126345 | ||
Organism | Escherichia coli strain DX6 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | QN223_RS06980 | Protein ID | WP_000911330.1 |
Coordinates | 1404259..1404657 (+) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | U9XQV3 |
Locus tag | QN223_RS06975 | Protein ID | WP_000450524.1 |
Coordinates | 1404032..1404259 (+) | Length | 76 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QN223_RS06950 (1399835) | 1399835..1400305 | - | 471 | WP_001068682.1 | thioredoxin-dependent thiol peroxidase | - |
QN223_RS06955 (1400305) | 1400305..1400877 | - | 573 | WP_000176187.1 | glycine cleavage system transcriptional repressor | - |
QN223_RS06960 (1401023) | 1401023..1401901 | + | 879 | WP_001295469.1 | 4-hydroxy-tetrahydrodipicolinate synthase | - |
QN223_RS06965 (1401918) | 1401918..1402952 | + | 1035 | WP_001297320.1 | outer membrane protein assembly factor BamC | - |
QN223_RS06970 (1403165) | 1403165..1403878 | + | 714 | WP_001295467.1 | phosphoribosylaminoimidazolesuccinocarboxamide synthase | - |
QN223_RS06975 (1404032) | 1404032..1404259 | + | 228 | WP_000450524.1 | toxin-antitoxin system antitoxin VapB | Antitoxin |
QN223_RS06980 (1404259) | 1404259..1404657 | + | 399 | WP_000911330.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
QN223_RS06985 (1404804) | 1404804..1405667 | + | 864 | WP_001267508.1 | neutral zinc metallopeptidase | - |
QN223_RS06990 (1405682) | 1405682..1407697 | + | 2016 | WP_000829329.1 | tRNA cytosine(34) acetyltransferase TmcA | - |
QN223_RS06995 (1407771) | 1407771..1408469 | + | 699 | WP_000679823.1 | esterase | - |
QN223_RS07000 (1408579) | 1408579..1408779 | - | 201 | WP_000383836.1 | YpfN family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 14894.25 Da Isoelectric Point: 9.2216
>T282874 WP_000911330.1 NZ_CP126345:1404259-1404657 [Escherichia coli]
MLKFMLDTNICIFTIKNKPVHVRERFNLNSGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRLVVLDYDSAAATHT
GQIRAELARQGRPVGPFDQMIAGHARSRGLIVVTNNTREFERVAGIRLEDWS
MLKFMLDTNICIFTIKNKPVHVRERFNLNSGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRLVVLDYDSAAATHT
GQIRAELARQGRPVGPFDQMIAGHARSRGLIVVTNNTREFERVAGIRLEDWS
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|