Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
Location | 701673..702508 | Replicon | chromosome |
Accession | NZ_CP126345 | ||
Organism | Escherichia coli strain DX6 |
Toxin (Protein)
Gene name | yeeV | Uniprot ID | A0A763DSF8 |
Locus tag | QN223_RS03390 | Protein ID | WP_047928871.1 |
Coordinates | 702131..702508 (+) | Length | 126 a.a. |
Antitoxin (Protein)
Gene name | yeeU | Uniprot ID | - |
Locus tag | QN223_RS03385 | Protein ID | WP_047928872.1 |
Coordinates | 701673..702041 (+) | Length | 123 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QN223_RS03360 (698555) | 698555..699373 | + | 819 | WP_182913012.1 | DUF932 domain-containing protein | - |
QN223_RS03365 (699711) | 699711..700184 | + | 474 | WP_001355870.1 | antirestriction protein | - |
QN223_RS03370 (700200) | 700200..700676 | + | 477 | WP_001186771.1 | RadC family protein | - |
QN223_RS03375 (700739) | 700739..700960 | + | 222 | WP_000692327.1 | DUF987 domain-containing protein | - |
QN223_RS03380 (700979) | 700979..701623 | + | 645 | WP_047928873.1 | hypothetical protein | - |
QN223_RS03385 (701673) | 701673..702041 | + | 369 | WP_047928872.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
QN223_RS03390 (702131) | 702131..702508 | + | 378 | WP_047928871.1 | TA system toxin CbtA family protein | Toxin |
QN223_RS03395 (702505) | 702505..702654 | + | 150 | Protein_665 | DUF5983 family protein | - |
QN223_RS03400 (702730) | 702730..702927 | + | 198 | WP_096093965.1 | DUF957 domain-containing protein | - |
QN223_RS03405 (703012) | 703012..703857 | + | 846 | WP_072650597.1 | DUF4942 domain-containing protein | - |
QN223_RS03415 (704157) | 704157..704663 | + | 507 | WP_000228937.1 | G/U mismatch-specific DNA glycosylase | - |
QN223_RS03420 (704742) | 704742..706583 | - | 1842 | WP_000437371.1 | RNA polymerase sigma factor RpoD | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 13941.88 Da Isoelectric Point: 7.3222
>T282871 WP_047928871.1 NZ_CP126345:702131-702508 [Escherichia coli]
MKTLPVLPGQAAGSRPSPVEIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
STCTHSQLINSIDILRARRATGLMTRDNYRTVNGITQGKHPEAKQ
MKTLPVLPGQAAGSRPSPVEIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
STCTHSQLINSIDILRARRATGLMTRDNYRTVNGITQGKHPEAKQ
Download Length: 378 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|