Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 3528904..3529522 | Replicon | chromosome |
Accession | NZ_CP126343 | ||
Organism | Escherichia coli strain DAX4 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | H5UYE2 |
Locus tag | QN220_RS17020 | Protein ID | WP_001291435.1 |
Coordinates | 3529304..3529522 (+) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | - |
Locus tag | QN220_RS17015 | Protein ID | WP_200931917.1 |
Coordinates | 3528904..3529278 (+) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QN220_RS17005 (3523993) | 3523993..3525186 | + | 1194 | WP_001295324.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
QN220_RS17010 (3525209) | 3525209..3528358 | + | 3150 | WP_001132469.1 | efflux RND transporter permease AcrB | - |
QN220_RS17015 (3528904) | 3528904..3529278 | + | 375 | WP_200931917.1 | Hha toxicity modulator TomB | Antitoxin |
QN220_RS17020 (3529304) | 3529304..3529522 | + | 219 | WP_001291435.1 | HHA domain-containing protein | Toxin |
QN220_RS17025 (3529694) | 3529694..3530245 | + | 552 | WP_153443482.1 | maltose O-acetyltransferase | - |
QN220_RS17030 (3530361) | 3530361..3530831 | + | 471 | WP_000136192.1 | YlaC family protein | - |
QN220_RS17035 (3530995) | 3530995..3532545 | + | 1551 | WP_001310610.1 | cyclic-guanylate-specific phosphodiesterase PdeB | - |
QN220_RS17040 (3532587) | 3532587..3532940 | - | 354 | WP_000878140.1 | DUF1428 domain-containing protein | - |
QN220_RS17050 (3533319) | 3533319..3533630 | + | 312 | WP_000409911.1 | MGMT family protein | - |
QN220_RS17055 (3533661) | 3533661..3534233 | - | 573 | WP_000779831.1 | YbaY family lipoprotein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T282861 WP_001291435.1 NZ_CP126343:3529304-3529522 [Escherichia coli]
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14600.42 Da Isoelectric Point: 4.9284
>AT282861 WP_200931917.1 NZ_CP126343:3528904-3529278 [Escherichia coli]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDRQKWRKSGNRLFRCFVNATKENPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDRQKWRKSGNRLFRCFVNATKENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|