Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 3015593..3016428 | Replicon | chromosome |
| Accession | NZ_CP126343 | ||
| Organism | Escherichia coli strain DAX4 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | A0A6H2GFM1 |
| Locus tag | QN220_RS14600 | Protein ID | WP_065304416.1 |
| Coordinates | 3015593..3015970 (-) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | A0A6H2GGB7 |
| Locus tag | QN220_RS14605 | Protein ID | WP_001285390.1 |
| Coordinates | 3016060..3016428 (-) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QN220_RS14565 (3010774) | 3010774..3012495 | + | 1722 | WP_001202175.1 | cysteine/glutathione ABC transporter ATP-binding protein/permease CydC | - |
| QN220_RS14570 (3012537) | 3012537..3013241 | + | 705 | WP_001241678.1 | leucyl/phenylalanyl-tRNA--protein transferase | - |
| QN220_RS14575 (3013526) | 3013526..3013744 | + | 219 | WP_001040187.1 | translation initiation factor IF-1 | - |
| QN220_RS14585 (3014235) | 3014235..3015077 | - | 843 | WP_065304417.1 | DUF4942 domain-containing protein | - |
| QN220_RS14590 (3015174) | 3015174..3015371 | - | 198 | WP_086598277.1 | DUF957 domain-containing protein | - |
| QN220_RS14595 (3015447) | 3015447..3015596 | - | 150 | Protein_2862 | DUF5983 family protein | - |
| QN220_RS14600 (3015593) | 3015593..3015970 | - | 378 | WP_065304416.1 | type IV toxin-antitoxin system cytoskeleton-binding toxin CbtA | Toxin |
| QN220_RS14605 (3016060) | 3016060..3016428 | - | 369 | WP_001285390.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| QN220_RS14610 (3016478) | 3016478..3017122 | - | 645 | WP_065304415.1 | antitoxin of toxin-antitoxin stability system | - |
| QN220_RS14615 (3017137) | 3017137..3017358 | - | 222 | WP_000692312.1 | DUF987 domain-containing protein | - |
| QN220_RS14620 (3017427) | 3017427..3017903 | - | 477 | WP_001186747.1 | RadC family protein | - |
| QN220_RS14625 (3017918) | 3017918..3018403 | - | 486 | WP_000214317.1 | antirestriction protein | - |
| QN220_RS14630 (3018494) | 3018494..3019315 | - | 822 | WP_106668205.1 | DUF932 domain-containing protein | - |
| QN220_RS14635 (3019536) | 3019536..3019946 | - | 411 | WP_000846713.1 | hypothetical protein | - |
| QN220_RS14640 (3019962) | 3019962..3020639 | - | 678 | WP_059239983.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14060.06 Da Isoelectric Point: 7.8522
>T282860 WP_065304416.1 NZ_CP126343:c3015970-3015593 [Escherichia coli]
MKTLPVLPGQAASSRPSPVEIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKYQEAKQ
MKTLPVLPGQAASSRPSPVEIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKYQEAKQ
Download Length: 378 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13811.52 Da Isoelectric Point: 5.9618
>AT282860 WP_001285390.1 NZ_CP126343:c3016428-3016060 [Escherichia coli]
VSDTFHETNYPDDNNDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDADSYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYMAVYPTPETKK
VSDTFHETNYPDDNNDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDADSYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYMAVYPTPETKK
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A6H2GFM1 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A6H2GGB7 |