Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 3015593..3016428 Replicon chromosome
Accession NZ_CP126343
Organism Escherichia coli strain DAX4

Toxin (Protein)


Gene name yeeV Uniprot ID A0A6H2GFM1
Locus tag QN220_RS14600 Protein ID WP_065304416.1
Coordinates 3015593..3015970 (-) Length 126 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID A0A6H2GGB7
Locus tag QN220_RS14605 Protein ID WP_001285390.1
Coordinates 3016060..3016428 (-) Length 123 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QN220_RS14565 (3010774) 3010774..3012495 + 1722 WP_001202175.1 cysteine/glutathione ABC transporter ATP-binding protein/permease CydC -
QN220_RS14570 (3012537) 3012537..3013241 + 705 WP_001241678.1 leucyl/phenylalanyl-tRNA--protein transferase -
QN220_RS14575 (3013526) 3013526..3013744 + 219 WP_001040187.1 translation initiation factor IF-1 -
QN220_RS14585 (3014235) 3014235..3015077 - 843 WP_065304417.1 DUF4942 domain-containing protein -
QN220_RS14590 (3015174) 3015174..3015371 - 198 WP_086598277.1 DUF957 domain-containing protein -
QN220_RS14595 (3015447) 3015447..3015596 - 150 Protein_2862 DUF5983 family protein -
QN220_RS14600 (3015593) 3015593..3015970 - 378 WP_065304416.1 type IV toxin-antitoxin system cytoskeleton-binding toxin CbtA Toxin
QN220_RS14605 (3016060) 3016060..3016428 - 369 WP_001285390.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
QN220_RS14610 (3016478) 3016478..3017122 - 645 WP_065304415.1 antitoxin of toxin-antitoxin stability system -
QN220_RS14615 (3017137) 3017137..3017358 - 222 WP_000692312.1 DUF987 domain-containing protein -
QN220_RS14620 (3017427) 3017427..3017903 - 477 WP_001186747.1 RadC family protein -
QN220_RS14625 (3017918) 3017918..3018403 - 486 WP_000214317.1 antirestriction protein -
QN220_RS14630 (3018494) 3018494..3019315 - 822 WP_106668205.1 DUF932 domain-containing protein -
QN220_RS14635 (3019536) 3019536..3019946 - 411 WP_000846713.1 hypothetical protein -
QN220_RS14640 (3019962) 3019962..3020639 - 678 WP_059239983.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(18-117)


Sequences

Toxin        


Download         Length: 126 a.a.        Molecular weight: 14060.06 Da        Isoelectric Point: 7.8522

>T282860 WP_065304416.1 NZ_CP126343:c3015970-3015593 [Escherichia coli]
MKTLPVLPGQAASSRPSPVEIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKYQEAKQ

Download         Length: 378 bp

Antitoxin


Download         Length: 123 a.a.        Molecular weight: 13811.52 Da        Isoelectric Point: 5.9618

>AT282860 WP_001285390.1 NZ_CP126343:c3016428-3016060 [Escherichia coli]
VSDTFHETNYPDDNNDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDADSYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYMAVYPTPETKK

Download         Length: 369 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A6H2GFM1

Antitoxin

Source ID Structure
AlphaFold DB A0A6H2GGB7

References