Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
Location | 1115074..1115915 | Replicon | chromosome |
Accession | NZ_CP126343 | ||
Organism | Escherichia coli strain DAX4 |
Toxin (Protein)
Gene name | yeeV | Uniprot ID | A0A1M0WJM1 |
Locus tag | QN220_RS05415 | Protein ID | WP_000854822.1 |
Coordinates | 1115074..1115457 (-) | Length | 128 a.a. |
Antitoxin (Protein)
Gene name | yeeU | Uniprot ID | A0A1M0CWL2 |
Locus tag | QN220_RS05420 | Protein ID | WP_053271974.1 |
Coordinates | 1115547..1115915 (-) | Length | 123 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QN220_RS05390 (1110458) | 1110458..1112710 | - | 2253 | Protein_1054 | alpha-amylase family glycosyl hydrolase | - |
QN220_RS05400 (1113444) | 1113444..1114289 | - | 846 | WP_001280435.1 | DUF4942 domain-containing protein | - |
QN220_RS05405 (1114386) | 1114386..1114583 | - | 198 | WP_000839263.1 | DUF957 domain-containing protein | - |
QN220_RS05410 (1114595) | 1114595..1115083 | - | 489 | WP_001177592.1 | DUF5983 family protein | - |
QN220_RS05415 (1115074) | 1115074..1115457 | - | 384 | WP_000854822.1 | type IV toxin-antitoxin system cytoskeleton-binding toxin CbtA | Toxin |
QN220_RS05420 (1115547) | 1115547..1115915 | - | 369 | WP_053271974.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
QN220_RS05425 (1115995) | 1115995..1116216 | - | 222 | WP_000692312.1 | DUF987 domain-containing protein | - |
QN220_RS05430 (1116285) | 1116285..1116761 | - | 477 | WP_001186747.1 | RadC family protein | - |
QN220_RS05435 (1116776) | 1116776..1117261 | - | 486 | WP_000214317.1 | antirestriction protein | - |
QN220_RS05440 (1117352) | 1117352..1118170 | - | 819 | WP_001234702.1 | DUF932 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 1111673..1127318 | 15645 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 128 a.a. Molecular weight: 14295.32 Da Isoelectric Point: 8.2830
>T282852 WP_000854822.1 NZ_CP126343:c1115457-1115074 [Escherichia coli]
MKTLPVLPGQAASSRPSPVEIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKHQESKRCN
MKTLPVLPGQAASSRPSPVEIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKHQESKRCN
Download Length: 384 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13679.41 Da Isoelectric Point: 6.4758
>AT282852 WP_053271974.1 NZ_CP126343:c1115915-1115547 [Escherichia coli]
VSDTFSGTTHPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLTDRAGIRGRFSDADANHLDQAFPLLMKQLELMLTSS
ELNPHRQNTVTLYVKGLTCHADTLGSCGYVYLAVYPTPEMKN
VSDTFSGTTHPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLTDRAGIRGRFSDADANHLDQAFPLLMKQLELMLTSS
ELNPHRQNTVTLYVKGLTCHADTLGSCGYVYLAVYPTPEMKN
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1M0WJM1 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1M0CWL2 |