282845

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) hicAB/HicA-HicB
Location 2466981..2467645 Replicon chromosome
Accession NZ_CP126342
Organism Pseudomonas otitidis strain TL17

Toxin (Protein)


Gene name hicA Uniprot ID -
Locus tag QN096_RS11555 Protein ID WP_069564973.1
Coordinates 2467460..2467645 (-) Length 62 a.a.

Antitoxin (Protein)


Gene name hicB Uniprot ID -
Locus tag QN096_RS11550 Protein ID WP_069564974.1
Coordinates 2466981..2467403 (-) Length 141 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QN096_RS11500 (QN096_11500) 2462692..2462946 + 255 WP_165667935.1 helix-turn-helix transcriptional regulator -
QN096_RS11505 (QN096_11505) 2462949..2463257 + 309 WP_284549310.1 CII family transcriptional regulator -
QN096_RS11510 (QN096_11510) 2463259..2464194 + 936 WP_284549312.1 DnaT-like ssDNA-binding domain-containing protein -
QN096_RS11515 (QN096_11515) 2464223..2464795 + 573 WP_284549314.1 replication protein P -
QN096_RS11520 (QN096_11520) 2464788..2464985 + 198 WP_284549316.1 hypothetical protein -
QN096_RS11525 (QN096_11525) 2464978..2465433 + 456 WP_284549317.1 RusA family crossover junction endodeoxyribonuclease -
QN096_RS11530 (QN096_11530) 2465430..2466008 + 579 WP_284549319.1 hypothetical protein -
QN096_RS11535 (QN096_11535) 2466092..2466301 + 210 WP_284549320.1 hypothetical protein -
QN096_RS11540 (QN096_11540) 2466357..2466638 - 282 WP_284549322.1 hypothetical protein -
QN096_RS11545 (QN096_11545) 2466706..2466984 - 279 WP_284549324.1 hypothetical protein -
QN096_RS11550 (QN096_11550) 2466981..2467403 - 423 WP_069564974.1 type II toxin-antitoxin system HicB family antitoxin Antitoxin
QN096_RS11555 (QN096_11555) 2467460..2467645 - 186 WP_069564973.1 type II toxin-antitoxin system HicA family toxin Toxin
QN096_RS11560 (QN096_11560) 2467756..2468145 + 390 WP_284549326.1 putative holin -
QN096_RS11565 (QN096_11565) 2468138..2468479 + 342 WP_284549328.1 phage holin family protein -
QN096_RS11570 (QN096_11570) 2468514..2468837 - 324 WP_284549330.1 hypothetical protein -
QN096_RS11575 (QN096_11575) 2469080..2469703 + 624 WP_284550132.1 putative metallopeptidase -
QN096_RS11580 (QN096_11580) 2469736..2470203 + 468 WP_284549331.1 DUF2280 domain-containing protein -
QN096_RS11585 (QN096_11585) 2470190..2471476 + 1287 WP_222901758.1 terminase family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 2440713..2498499 57786


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

HicA mRNA interferase family

(3-59)

Antitoxin

HicB-like antitoxin of toxin-antitoxin system

(4-62)


Sequences

Toxin        


Download         Length: 62 a.a.        Molecular weight: 7156.25 Da        Isoelectric Point: 11.0258

>T282845 WP_069564973.1 NZ_CP126342:c2467645-2467460 [Pseudomonas otitidis]
MKYSEFRRWLESQGVTFSKSAKGSHFKIRYRGRQTIFPNHGAKEISEGLRKDIIKQLGLKD

Download         Length: 186 bp

Antitoxin


Download         Length: 141 a.a.        Molecular weight: 15465.50 Da        Isoelectric Point: 4.7903

>AT282845 WP_069564974.1 NZ_CP126342:c2467403-2466981 [Pseudomonas otitidis]
MVNYPISVHRENDHYWSSCPDLPEAHSAGDTLEELLANAVEGIQLAMSIYVDQGREIPAASEPEPGQHVIYQPIQFAAKA
ALWNAMREQGLRVADLARLLEVSHPVAARLVDFEHTSKIEQLERALASLGKRITLSLEAA

Download         Length: 423 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References